The URL can be used to link to this page

Home My WebLink AboutCity Arts Commission 02-13-2025 Meeting Agenda PacketCITY OF NEWPORT BEACH CITY ARTS COMMISSION AGENDA Newport Beach Central Library - Small Conference Room 1000 Avocado Avenue, Newport Beach 92660 Thursday, February 13, 2025 - 5:00 PM City Arts Commission Members: Melissa Kandel, Chair John Blom, Vice Chair Heather Ignatin, Secretary Maureen Flanagan, Commissioner Barbara George, Commissioner Wayan Kaufman, Commissioner Vanessa Moore, Commissioner Staff Members: Melissa Hartson, Library Services Director Camille Escareal-Garcia, Cultural Arts Assistant The City Arts Commission meeting is subject to the Ralph M. Brown Act. Among other things, the Brown Act requires that the City Arts Commission agenda be posted at least seventy-two (72) hours in advance of each regular meeting and that the public be allowed to comment on agenda items before the Commission and items not on the agenda but are within the subject matter jurisdiction of the City Arts Commission. The Chair may limit public comments to a reasonable amount of time, generally three (3) minutes per person. The public can submit questions and comments in writing for the City Arts Commission to consider. Please send them by email to the Library Services Department at ArtsCommission@newportbeachca.gov by Wednesday, February 12, 2025, at 5:00 p.m. to give the City Arts Commissioners time to consider your comments. All emails will be made part of the record. The City of Newport Beach’s goal is to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, you will need special assistance beyond what is normally provided, we will attempt to accommodate you in every reasonable manner. Please contact Melissa Hartson, Library Services Director, at least forty-eight (48) hours prior to the meeting to inform us of your particular needs and to determine if accommodation is feasible at (949) 717-3801 or mhartson@newportbeachca.gov. NOTICE REGARDING PRESENTATIONS REQUIRING USE OF CITY EQUIPMENT Any presentation requiring the use of the City of Newport Beach’s equipment must be submitted to the Library Services Department 24 hours prior to the scheduled meeting. I.CALL MEETING TO ORDER II.ROLL CALL III.PLEDGE OF ALLEGIANCE IV.NOTICE TO THE PUBLIC The City provides a yellow sign-in card to assist in the preparation of the minutes. The completion of the card is not required in order to address the City Arts Commission. If the optional sign-in card has been completed, it should be placed in the tray provided. The City Arts Commission of Newport Beach welcomes and encourages community participation. Public comments are generally limited to three (3) minutes per person to allow everyone to speak. Written comments are encouraged as well. The City Arts Commission has the discretion to extend or shorten the time limit on agenda or non-agenda items. As a courtesy, please turn cell phones off or set them in the silent mode. February 13, 2025 Page 2 City Arts Commission Meeting V.PUBLIC COMMENTS ON CONSENT CALENDAR Public comments are invited on agenda items. Speakers must limit comments to three (3) minutes. Before speaking, we invite, but do not require, you to state your name for the record. The City Arts Commission has the discretion to extend or shorten the speakers’ time limit on agenda items, provided the time limit adjustment is applied equally to all speakers. As a courtesy, please turn cell phones off or set them in the silent mode. VI.CONSENT CALENDAR All matters listed under CONSENT CALENDAR are considered to be routine and will all be enacted by one motion in the form listed below. City Arts Commissioners have received detailed staff reports on each of the items recommending an action. There will be no separate discussion of these items prior to the time the City Arts Commission votes on the motion unless members of the City Arts Commission request specific items to be discussed and/or removed from the Consent Calendar for separate action. Members of the public who wish to discuss a Consent Calendar item should come forward to the lectern upon invitation by the Chair. A.Approval of Minutes of the December 12, 2024, City Arts Commission Meeting Draft of 12/12/2024 Minutes1. Draft of 12-12-2024 Meeting Minutes B.Consent Calendar Items Financial Report2. Review of financial information. Financial Report Cultural Arts Activities3. Monthly review of cultural arts activities from the Library Administrative Office for upcoming Library and City arts events and services. Cultural Arts Activities VII.CURRENT BUSINESS A.Items for Review and Possible Action Newport Beach Art Exhibition Entry Guidelines4. The Newport Beach Art Exhibition (NBAE) Ad Hoc Subcommittee recommends that the City Arts Commission approve revisions to the annual art exhibition entry guidelines. Revisions to NBAE Entry Guidelines - Staff Report Attachment A Attachment B Attachment C February 13, 2025 Page 3 City Arts Commission Meeting Fiscal Year 2024-25 Cultural Arts Grants5. Staff recommends that the City Arts Commission review grant applications and approve the recipients for recommendation to City Council for the FY 2024-25 Cultural Arts Grants in accordance with City Council Policy 1-10 - Culture and Arts Grants. Cultural Arts Grants Staff Report Attachment A Attachment B Attachment C Attachment D Attachment E Attachment F Attachment G Attachment H Attachment I Attachment J Attachment K Attachment L Attachment M 2024 Summer Concerts on the Civic Green and Fall Concert at Marina Park6. Staff recommends the City Arts Commission review and approve the Music and Live Entertainment Ad Hoc Subcommittee’s recommendations of two bands, a Pacific Symphony performance, and two alternate bands for the summer concert series on the Civic Center Green, as well as review and approve a band and an alternate for the fall concert at Marina Park. Band Recommendations - Staff Report Attachment A B.Monthly Reports Art in Public Places Ad Hoc Subcommittee7. Vice Chair Blom, Commissioner Flanagan, Commissioner Moore Music and Live Entertainment Ad Hoc Subcommittee8. Chair Kandel, Secretary Ignatin, Commissioner Flanagan Cultural Arts Grants Ad Hoc Subcommittee9. Vice Chair Blom, Secretary Ignatin, Commissioner Flanagan February 13, 2025 Page 4 City Arts Commission Meeting Newport Beach Art Exhibition Ad Hoc Subcommittee10. Chair Kandel, Vice Chair Blom, Secretary Ignatin Public Relations and Marketing Ad Hoc Subcommittee11. Chair Kandel, Vice Chair Blom, Secretary Ignatin Sculpture Exhibition Ad Hoc Subcommittee12. Chair Kandel, Vice Chair Blom, Secretary Ignatin Student Art Exhibition Ad Hoc Subcommittee13. Commissioner Kaufman Newport Beach Arts Foundation Liaison14. Commissioner Moore Historical Resources Liaison15. Vice Chair Blom VIII.CITY ARTS COMMISSION ANNOUNCEMENTS OR MATTERS WHICH MEMBERS WOULD LIKE PLACED ON A FUTURE AGENDA FOR DISCUSSION, ACTION OR REPORT (NON-DISCUSSION ITEM) IX.PUBLIC COMMENTS ON NON-AGENDA ITEMS Public comments are invited on non-agenda items generally considered to be within the subject matter jurisdiction of the City Arts Commission. Speakers must limit comments to three (3) minutes. Before speaking, we invite, but do not require, you to state your name for the record. The City Arts Commission has the discretion to extend or shorten the speakers’ time limit on agenda or non-agenda items, provided the time limit adjustment is applied equally to all speakers. As a courtesy, please turn cell phones off or set them in the silent mode. X.ADJOURNMENT CITY OF NEWPORT BEACH CITY ARTS COMMISSION MINUTES Newport Beach Public Library 1000 Avocado Avenue, Newport Beach, CA 92660 Thursday, December 12, 2024 – Regular Meeting City Arts Commission Members: Melissa Kandel, Chair John Blom, Vice Chair Heather Ignatin, Secretary Maureen Flanagan, Commissioner Barbara George, Commissioner Wayan Kaufman, Commissioner Vanessa Moore, Commissioner Staff Members: Melissa Hartson, Library Services Director Camille Escareal-Garcia, Cultural Arts Assistant DRAFT I. CALL MEETING TO ORDER Chair Melissa Kandel called the City Arts Commission Regular Meeting to order at 5:00 P.M. II. ROLL CALL Commissioners Present: Chair Melissa Kandel Commissioner Wayan Kaufman Commissioner Vanessa Moore Commissioner Maureen Flanagan Commissioner Barbara George Commissioners Absent: Vice Chair John Blom (excused) Secretary Heather Ignatin (excused) Staff Present: Melissa Hartson, Library Services Director Camille Escareal-Garcia, Cultural Arts Assistant III. PLEDGE OF ALLEGIANCE Chair Kandel led the Pledge of Allegiance. IV. NOTICE TO THE PUBLIC - Waived V. PUBLIC COMMENTS None VI. CONSENT CALENDAR 5 City Arts Commission Meeting December 12, 2024 Page 2 A. Approval of Minutes of November 14, 2024, City Arts Commission Meeting 1. Draft of 11/14/24 Minutes Chair Kandel requested edits, changes, or deletions of the minutes, there were none. B. Consent Calendar Items 2. Financial Report Review of financial information. 3. Cultural Arts Activities Monthly review of cultural arts activities from the Library Administrative Office for upcoming Library and City arts events and services. Chair Kandel opened the Consent Calendar for public comment, there were none. Motion made by Commissioner Vanessa Moore, seconded by Chair Melissa Kandel, to accept the Consent Calendar and carried 5-0-0-2 (with Commissioners Blom and Ignatin absent) VII. CURRENT BUSINESS A. Items for Review and Possible Action 4. Proposal for a Poet Laureate Pilot Program in Newport Beach The City Arts Commission will review and discuss the Music and Live Entertainment Ad Hoc Subcommittee suggestions for creating a Poet Laureate Pilot Program. Director Hartson reported on the proposal for a Poet Laureate Pilot Program based on Gianna D’Egidio’s submission to the Music and Live Entertainment subcommittee. In reviewing the proposal, the subcommittee suggested including poetry performances at City Arts Commission events and possibly introducing a student poetry contest. Commissioner George inquired if there is a cost for the program and if there is any budget involved. Library Services Director Hartson responded that currently the financial cost appeared to be minimal, there would be no honorariums paid, and minimal cost for advertising the contest. There is a small amount of extra money available in the budget for such expenditures. Chair Kandel explained that whoever took the lead for the program would also be in charge of spearheading the poetry contest. The Commission would have a role but would not be the ones administering the contest. Commissioner Moore asked if it could also be incorporated into readings at the libraries. Chair Kandel stated that it could potentially grow into a larger program, they were first interested in seeing how it unfolded during the first year. Chair Kandel opened public comment. 6 City Arts Commission Meeting December 12, 2024 Page 3 Gianna D’Egidio, Newport Beach resident, thanked the Commission for considering the proposal and respecting the role of poets within the city. Poetry has been an important way to preserve stories and art culture, she appreciates the Commission recognizing that and moving forward with the program. She is available for involvement if the Commission is interested in her assistance. Chair Kandel closed public comment. B. Monthly Reports 5. Art in Public Places Ad Hoc Subcommittee Vice Chair Blom, Commissioner Flanagan, Commissioner Moore Commissioner Moore reported the subcommittee reached out to the artists that were not approved and asked them to submit more work if they were interested in doing so. 6. Music and Live Entertainment Ad Hoc Subcommittee Chair Kandel, Secretary Ignatin, Commissioner Flanagan Chair Kandel stated the subcommittee is in the process of reviewing the submissions that were provided by Cultural Arts Assistant Escareal-Garcia, they will set a meeting date and return to the Commission at a future date. 7. Cultural Arts Grants Ad Hoc Subcommittee Vice Chair Blom, Commissioner Kaufman, Commissioner Moore Commissioner Moore reported the committee had been working on submitting information to different art groups around the city to better gage interest in applying for grants. They are waiting to hear if there is an option for Newport Theatre Arts Center to apply for grant funding. The theater had been previously denied from applying for grants because it is on City property, which may be against policy for requesting additional funds. The Commission is welcome to provide feedback on any specific organizations that they know may have an interest. All Arts Commissioners can reach out to organizations to apply, the subcommittee is not a screening panel for outreach. 8. Newport Beach Art Exhibition Ad Hoc Subcommittee Commissioner George, Commissioner Kaufman, Commissioner Moore Commissioner Moore stated there is nothing to report until after the new year. 9. Public Relations and Marketing Ad Hoc Subcommittee Chair Kandel, Vice Chair Blom, Secretary Ignatin Chair Kandel stated there is nothing to report until after the first of the year. 10. Sculpture Exhibition Ad Hoc Subcommittee Chair Kandel, Vice Chair Blom, Secretary Ignatin Chair Kandel stated there is nothing to report. 7 City Arts Commission Meeting December 12, 2024 Page 4 11. Student Exhibition Art Ad Hoc Subcommittee Commissioner Kaufman Commissioner Kaufman stated there is nothing current to report. 12. Newport Beach Arts Foundation (NBAF) Liaison Commissioner Moore Commissioner Moore reported they canceled their meeting, there is nothing to report. 13. Historical Resources Liaison Vice Chair Blom Chair Kandel reported that the Historical Society hired a marketing agency to help look into more events and more sponsorships. Potentially there will be more events coming from their group. Chair Kandel opened each item for Public Comment and there were none. IX. CITY ARTS COMMISSION ANNOUNCEMENTS OR MATTERS WHICH MEMBERS WOULD LIKE PLACED ON A FUTURE AGENDA FOR DISCUSSION, ACTION, OR REPORT (NON-DISCUSSION ITEM) Commissioner Moore attended the General Plan meeting; the General Plan website has been updated and they are still seeking input and feedback on where the community sees the Arts and Historical resources in fifty years. Commissioner Kaufman inquired if they still planned to apply the ten thousand dollars restricted funds on a future agenda. Chair Kandel responded that it would be added to an agenda on a date uncertain. Director Hartson stated that she is looking into it and would connect with Commissioner Kaufman after the meeting. X. PUBLIC COMMENTS ON NON-AGENDA ITEMS None XI. ADJOURNMENT – 5:16 P.M. Chair Kandel adjourned the meeting. 8 As of February 1, 2025 ACCT NAME BUDGET DATE VENDOR EXPENSES AVAILABLE NOTES Programming 60,500.00$ 07/11 DJE Sound and Lighting 4,337.67 56,162.33 COTG Sound -07-21-2024 (Radio Rebels) 07/11 Rebel Music Entertainment 3,250.00 52,912.33 COTG Band - 07-21-2024 (Radio Rebels) 07/25 Mr. Rock N' Roll Inc.3,250.00 49,662.33 COTG Band - 08-11-2024 (Wilbury Super Group) 07/25 DJE Sound and Lighting 4,337.67 45,324.66 COTG Sound - 08-11-2024 (Wilbury Super Group) 07/31 Paul's Flowers 258.60 45,066.06 2024 Art Exhibition - Flowers 07/31 FEDEX Office 90.47 44,975.59 Concerts on the Green signs 08/01 Alliant Insurance Services 2,506.00 42,469.59 Insurance for Concerts on the Green 08/01 Tracy Kiggen (ARTovator)958.00 41,511.59 Children's Activities - 07-21-2024 (Radio Rebels) & Business License Fee 08/01 Tracy Kiggen (ARTovator)615.00 40,896.59 Children's Activities - 08-11-2024 (Wilbury Super Group) 08/08 Amazon.com 26.93 40,869.66 Concerts on the Green supplies 08/08 Amazon.com 19.66 40,850.00 Concerts on the Green supplies 08/23 WESTAF (CallforEntry.org)525.00 40,325.00 CallforEntry.org 2024 Art Exhibition Processing Fee08/23 Tracy Kiggen (ARTovator)615.00 39,710.00 Children's Activities - 09-22-2024 (AbSOULute) 08/30 DJE Sound and Lighting 4,337.67 35,372.33 COTG Sound -09-22-2024 (AbSOULute) 08/30 Leon Chalnick 3,250.00 32,122.33 COTG Band - 09-22-2024 (AbSOULute) 10/03 Kleenway Services Inc.134.70 31,987.63 COTG Dayporters 07-21-2024 (Radio Rebels) 10/03 Kleenway Services Inc.134.70 31,852.93 COTG Dayporters 08-11-2024 (Wilbury Super Group)10/03 Kleenway Services Inc.134.70 31,718.23 COTG Dayporters 09-22-2024 (AbSOULute) 10/17 Amazon.com 14.97 31,703.26 Halloween Spooktacular supplies 10/17 Amazon.com 37.60 31,665.66 Halloween Spooktacular supplies 10/17 Amazon.com 34.90 31,630.76 Halloween Spooktacular supplies 10/17 Amazon.com 114.20 31,516.56 Halloween Spooktacular supplies 10/17 Amazon.com 23.97 31,492.59 Halloween Spooktacular supplies 10/24 Amazon.com 63.88 31,428.71 Halloween Spooktacular supplies 10/24 Amazon.com 28.00 31,400.71 Halloween Spooktacular supplies 10/31 Gotprint.com 48.44 31,352.27 Halloween Spooktacular banner 10/31 Trader Joe's 467.16 30,885.11 Halloween Spooktacular supplies 10/31 Costco 39.98 30,845.13 Halloween Spooktacular supplies 10/31 Amazon.com 10.71 30,834.42 Halloween Spooktacular supplies 10/31 Creative West 60.00 30,774.42 CallforEntry.org Account Renewal 10/31 Creative Market 10.20 30,764.22 Font for Spooktacular Banner 12/05 Amazon.com 171.29 30,603.13 Art cleaning supplies 12/05 Amazon.com 33.27 30,569.86 Library Gallery exhibit supplies TOTAL $60,500.00 $29,940.34 $30,569.86 City Grants 30,000.00$ TOTAL $30,000.00 $0.00 $30,000.00 Professional Services 23,000.00$ 08/15 TAVD Virtual Assistant 159.75 22,840.25 Transcription of Minutes (07/11) 08/23 Svartifoss Corp 75.00 22,765.25 Art Installation (Indivisible - Sister City Artwork) 08/23 Svartifoss Corp 400.00 22,365.25 Art Installation (Christopher Evans exhibit) 08/30 Crown Building Services 825.00 21,540.25 Sculpture Maintenance 09/13 TAVD Virtual Assistant 76.50 21,463.75 Transcription of Minutes (08/08) 09/27 Svartifoss Corp 350.00 21,113.75 Art Installation (Shant Beudjekian) 10/17 TAVD Virtual Assistant 85.50 21,028.25 Transcription of Minutes (09/12) 10/31 Image360 186.62 20,841.63 Plaque for Indivisible artwork 11/22 TAVD Virtual Assistant 85.50 20,756.13 Transcription of Minutes (10/10) 11/29 Svartifoss Corp 250.00 20,506.13 Art Installation (Faro Mohajedi exhibit) 12/12 Crown Building Services 825.00 19,681.13 Sculpture Maintenance 12/19 TAVD Virtual Assistant 130.50 19,550.63 Transcription of Minutes (11/14) 01/16 TAVD Virtual Assistant 33.75 19,516.88 Transcription of Minutes (12/12) 01/30 Svartifoss Corp 325.00 19,191.88 Art Installation (Tianyi Wang) TOTAL 23,000.00$ $3,808.12 19,191.88$ FY 2024-25Cultural Arts Division 1 of 9 As of February 1, 2025 ACCT NAME BUDGET DATE VENDOR EXPENSES AVAILABLE NOTES FY 2024-25Cultural Arts Division Sculpture Exhibition 135,000.00$ TOTAL $135,000.00 $0.00 $135,000.00 Advertising $ 1,340.00 07/31 Gotprint.com 181.41 1,158.59 COTG rack card 07/31 Gotprint.com 120.78 1,037.81 COTG banners 08/31 Gotprint.com 67.38 970.43 Large Concerts on the Green banner 09/30 Gotprint.com 115.56 854.87 Marina Park rack cards 09/30 Gotprint.com 85.59 769.28 Marina Park banners 09/30 Gotprint.com 74.34 694.94 Large Marina Park banner TOTAL $1,340.00 $645.06 $694.94 REVENUES Special Events (NBAE) $0.00 TOTAL $0.00 $0.00 BUDGET EXPENSES AVAILABLE Cultural Arts Totals $249,840.00 $34,393.52 $215,456.68 of 10 CITY OF NEWPORT BEACH CITY ARTS COMMISSION STAFF REPORT February 13, 2025 Agenda Item No. 3 CENTRAL LIBRARY GALLERY EXHIBITS Tianyi Wang, a photographer from Liaoning, China, now based in Los Angeles, is dedicated to storytelling through visual art. His cinematic works emphasize composition and innovative color theory, using dynamic contrasts to create a striking visual impact. Specializing in street photography, Wang captures the authentic moments and emotions of urban life, crafting compelling narratives that are subtle yet powerful. This exhibition showcases his vibrant street photographs, inviting viewers into the unembellished beauty and poetic essence of city life. Through his lens, his works whisper eloquently, offering a rare glimpse into the complexities of the human experience. Artwork will be on display until March 7, 2025. UPCOMING CENTRAL LIBRARY GALLERY EXHIBITS: 2025: x Liberty Dickinson (Acrylic paintings): March 10 – May 2 x Joan Gladstone (Giclées): May 5 – June 27 x Kathy Kehoe Bambeck (Puzzle Paintings): June 30 – August 22 x Joe Cladis (Lithographs): August 25 – October 17 x Susan Neas (Watercolor Mosaics): October 20 – December 12 x Hugo Zhang (Photography): December 15 – February 6 TO:CITY ARTS COMMISSION FROM:Library Services Department Melissa Hartson, Library Services Director (949) 717-3801, mhartson@newportbeachca.gov PREPARED BY:Camille Escareal-Garcia, Cultural Arts Assistant TITLE: Cultural Arts Activities for January 2025 11 Cultural Arts Activities for January 2025 02/13/2025 Page 2 CULTURAL ARTS CALENDER OF EVENTS: City Arts Commission (CAC) meetings are held at 5 p.m. on the second Thursday of each month. x 2025 CAC Regular Monthly Meetings: o January 9, 2025 (canceled) o February 13, 2025 o March 13, 2025 o April 10, 2025 o May 8, 2025 o June 12, 2025 o July 10, 2025 o August 14, 2025 o September 11, 2025 o October 9, 2025 o November 13, 2025 o December 11, 2025 x 58th Annual Newport Beach Art Exhibition: Saturday, June 28, 2025 12 CITY OF NEWPORT BEACH CITY ARTS COMMISSION STAFF REPORT February 13, 2025 Agenda Item No. 4 RECOMMENDATION: The Newport Beach Art Exhibition (NBAE) Ad Hoc Subcommittee recommends the City Arts Commission approve revisions to the annual art exhibition entry guidelines. DISCUSSION: The Newport Beach Art Exhibition is an annual art competition that presents an opportunity for artists to show and sell their artwork to the public in a one-day exhibit. The exhibition features recently created original artwork in various mediums, including oils and acrylics, watercolor, charcoal, pen and ink, sculpture, photography, and mixed media. The 58th Annual Newport Beach Art Exhibition will be on Saturday, June 28, 2025, and will be held at the Newport Beach Civic Center (100 Civic Center, Newport Beach 92660). The call for entries will open in early March 2025. The NBAE Ad Hoc Subcommittee reviewed the exhibition entry guidelines and recommends revisions meant to provide clarity for the application process and requirements for entry. Upon approval, the entry guidelines will be updated on the City website, CallforEntry.org, and on all marketing material for the art exhibition. NOTICING: The agenda item has been noticed according to the Brown Act (72 hours in advance of the meeting at which the City Arts Commission considers the item). ATTACHMENT A: Newport Beach Art Exhibition Entry Guidelines - Original ATTACHMENT B: Newport Beach Art Exhibition Entry Guidelines - Redlined ATTACHMENT C: Newport Beach Art Exhibition Entry Guidelines - Final TO:CITY ARTS COMMISSION FROM:Library Services Department Melissa Hartson, Library Services Director (949) 717-3801, mhartson@newportbeachca.gov PREPARED BY:Melissa Hartson, Library Services Director TITLE: Revisions to the Newport Beach Art Exhibition Entry Guidelines 13 Newport Beach Art Exhibition Entry Guidelines The Newport Beach Art Exhibition presents an opportunity for artists to show and sell their artwork to the public in a one-day exhibit. x Exhibition is limited to two (2) works of art per artist. Registration is required and will be limited as space permits. x The 2025 NBAE deadline for entries will be Friday, May 9, 2025, or at Art Exhibition capacity as determined by the City Arts Commission. x Works of art can be: paintings (oil, watercolor, acrylic), drawings (ink, pencil, pastel, charcoal), mixed media, sculpture, or photography. x Entry fees: $35 for one entry and $50 for two entries. No refunds once artwork has been accepted. * x Original artwork only, please do not submit works copied from published photos, artist reproductions or Giclée. Photography must be signed and numbered. x A photo of each artwork must be submitted with entry. No substitutions allowed after entry is accepted. x Two-dimensional artwork size limit: 36” wide x 48” high. (A frame is required but dimensions do not include the frame). x Artist must provide a table-top easel to display two-dimensional artwork up to 24” x 24”. ** x Artist must provide a sturdy standup easel for artwork with any dimensions larger than 24” x 24”. ** x Three-dimensional size limit: Only works 150 lbs. or less will be accepted. Artist must provide pedestal for three-dimensional artwork. x Exhibiting artists must be accomplished artists 18 years of age or older. x Artworks must be delivered and retrieved in person – or by a designated representative – on the assigned date and time. NBAE can neither accept nor return any shipped artwork. ALL ARTWORK MUST REMAIN AT THE EXHIBITION UNTIL 5 P.M. x Work must be for sale. A 20% donation to the Newport Beach Arts Foundation is required on all sales. x Regarding diptych or triptych artwork: Overall dimensions of the combined artwork must not exceed the size limit of 36” x 48”, must be sold in its entirety as one "55"$).&/5"03*(*/"- 14 piece, and will be eligible for the competition as a singular art piece *EASELS GUIDE Acceptable Standing Easels: Not Acceptable Standing Easels: Acceptable Tabletop Easels 15 Not Acceptable Tabletop Easels: * Subject to cancellation/postponement. In the event the Art Exhibition is canceled, Entry Fee will be refunded in full. ** Easels deemed unstable by the event curator cannot be used. Unless an acceptable replacement is provided, the artwork may not be exhibited, and the entry fee will be forfeited. NOTE: W-9 required for awarding of cash prizes. Questions: Call (949) 717-3802 or send an email to arts@newportbeachca.gov 16 Newport Beach Art Exhibition Entry Guidelines The Newport Beach Art Exhibition presents an opportunity for artists to show and sell their artwork to the public in a one-day exhibit. x Exhibition is limited to two (2) works of art per artist. Registration is required and will be limited as space permits. x The 58th Annual Newport Beach Art Exhibition deadline for entries will be Friday, May 9, 2025 Íťϙ͐͐ϙŕϟıϟϙϙϼÍèĖƱèϙťÍĲîÍŘîϙĖıôϽ, or at Art Exhibition capacity as determined by the City Arts Commission. x Works of art can be: paintings (oil, watercolor, acrylic), drawings (ink, pencil, pastel, charcoal), mixed media, sculpture, or photography. x Entry fees: $35 for one entry and $50 for two entries. No refunds once artwork has been accepted. * x Work must be for sale. A 20% donation to the Newport Beach Arts Foundation is required on all sales. Artists cannot change the price of their artwork once the call has closed. x Original artwork only, please do not submit works copied from published photos, artist reproductions or Giclée. Photography must be signed and numbered. x A photo of each artwork must be submitted with entry. No substitutions allowed after entry is accepted. x Two-dimensional artwork size limit: 36” wide x 48” high. (A frame is required but dimensions do not include the frame). x A frame is required for all two-dimensional artwork excluding canvases 2” thick or more. If your artwork requires an exclusion to the frame requirement, please indicate on the application the reason why your art will be unframed for the exhibition.** x Regarding diptych or triptych artwork: Overall dimensions of the combined artwork must not exceed the size limit of 36” x 48”, and will be eligible for the competition as a singular art piece x Artist must provide a table-top easel to display two-dimensional artwork up to 24” x 24”. *** x Artist must provide a sturdy standup easel for artwork with any dimensions larger than 24” x 24”. *** "55"$).&/5#3&7*4*0/4 17 x Three-dimensional size limit: Works must not exceed 60” height or 75 lbs. without prior approval. Artist must provide pedestal for three-dimensional artwork. x Exhibiting artists must be accomplished artists 18 years of age or older. x Artworks must be delivered and retrieved in person – or by a designated representative – on the assigned date and time. The Newport Beach Art Exhibition can neither accept nor return any shipped artwork. ALL ARTWORK MUST REMAIN AT THE EXHIBITION UNTIL 5 P.M. EASELS GUIDE Acceptable Standing Easels: Not Acceptable Standing Easels: 18 Acceptable Tabletop Easels Not Acceptable Tabletop Easels: *Subject to cancellation/postponement. In the event the Art Exhibition is canceled, Entry Fee will be refunded in full. **Artwork that is unframed (without prior approval) or does not meet the eligibility guidelines listed above will not be exhibited, and the entry fee will be forfeited. *** Easels deemed unstable by the event curator cannot be used. Unless an acceptable replacement is provided, the artwork may not be exhibited, and the entry fee will be forfeited. NOTE: W-9 required for awarding of cash prizes. Questions: Call (949) 717-3802 or send an email to arts@newportbeachca.gov 19 Newport Beach Art Exhibition Entry Guidelines The Newport Beach Art Exhibition presents an opportunity for artists to show and sell their artwork to the public in a one-day exhibit. x Exhibition is limited to two (2) works of art per artist. Registration is required and will be limited as space permits. x The 58th Annual Newport Beach Art Exhibition deadline for entries will be Friday, May 9, 2025 Íťϙ͐͐ϙŕϟıϟϙϙϼÍèĖƱèϙťÍĲîÍŘîϙĖıôϽ, or at Art Exhibition capacity as determined by the City Arts Commission. x Works of art can be: paintings (oil, watercolor, acrylic), drawings (ink, pencil, pastel, charcoal), mixed media, sculpture, or photography. x Entry fees: $35 for one entry and $50 for two entries. No refunds once artwork has been accepted. * x Work must be for sale. A 20% donation to the Newport Beach Arts Foundation is required on all sales. Artists cannot change the price of their artwork once the call has closed. x Original artwork only, please do not submit works copied from published photos, artist reproductions or Giclée. Photography must be signed and numbered. x A photo of each artwork must be submitted with entry. No substitutions allowed after entry is accepted. x Two-dimensional artwork size limit: 36” wide x 48” high. (A frame is required but dimensions do not include the frame). x A frame is required for all two-dimensional artwork excluding canvases 2” thick or more. If your artwork requires an exclusion to the frame requirement, please indicate on the application the reason why your art will be unframed for the exhibition.** x Regarding diptych or triptych artwork: Overall dimensions of the combined artwork must not exceed the size limit of 36” x 48”, and will be eligible for the competition as a singular art piece x Artist must provide a table-top easel to display two-dimensional artwork up to 24” x 24”. *** x Artist must provide a sturdy standup easel for artwork with any dimensions larger than 24” x 24”. *** "55"$).&/5$'*/"- 20 x Three-dimensional size limit: Works must not exceed 60” height or 75 lbs. without prior approval. Artist must provide pedestal for three-dimensional artwork. x Exhibiting artists must be accomplished artists 18 years of age or older. x Artworks must be delivered and retrieved in person – or by a designated representative – on the assigned date and time. The Newport Beach Art Exhibition can neither accept nor return any shipped artwork. ALL ARTWORK MUST REMAIN AT THE EXHIBITION UNTIL 5 P.M. EASELS GUIDE Acceptable Standing Easels: Not Acceptable Standing Easels: 21 Acceptable Tabletop Easels Not Acceptable Tabletop Easels: * Subject to cancellation/postponement. In the event the Art Exhibition is canceled, Entry Fee will be refunded in full. **Artwork that is unframed (without prior approval) or does not meet the eligibility guidelines listed above will not be exhibited, and the entry fee will be forfeited. *** Easels deemed unstable by the event curator cannot be used. Unless an acceptable replacement is provided, the artwork may not be exhibited, and the entry fee will be forfeited. NOTE: W-9 required for awarding of cash prizes. Questions: Call (949) 717-3802 or send an email to arts@newportbeachca.gov 22 CITY OF NEWPORT BEACH CITY ARTS COMMISSION STAFF REPORT February 13, 2025 Agenda Item No. 5 ABSTRACT: The sum of $30,000 is provided for specific cultural or artistic planning or projects as approved by the City Council. The City Arts Commission has the responsibility to review all programs and requests for support from arts groups and make recommendations for funding to the City Council for final approval. RECOMMENDATION: Staff recommends that the City Arts Commission review the grant applications and approve the Cultural Arts Grants Ad Hoc Subcommittee recipients for recommendation to City Council for the Fiscal Year (FY) 2024-25 Cultural Arts Grants in accordance with City Council Policy I-10, Culture and Arts Grants. FUNDING REQUIREMENTS: The current adopted budget includes sufficient funding for this expenditure. Funds will be taken from the Cultural Arts Grants budget. DISCUSSION: City Council Policy I-10, Culture and Arts Grants, recognizes the importance of promoting culture and the arts within the City. The sum of $30,000 has been provided in FY 2024-25 for specific cultural or artistic planning or projects as approved by the City Council. The City Arts Commission has the responsibility to review all programs and requests for support from arts groups and make recommendations for funding to the City Council for final approval. TO:CITY ARTS COMMISSION FROM:Library Services Department Melissa Hartson, Library Services Director (949) 717-3801, mhartson@newportbeachca.gov PREPARED BY:Melissa Hartson, Library Services Director TITLE: Fiscal Year 2024-25 Cultural Arts Grants 23 CITY OF NEWPORT BEACH CITY ARTS COMMISSION STAFF REPORT 2 of 2 The Commission received written grant proposals from ten organizations for funding of approximately $85,100 in free cultural arts programming for the Newport Beach community in 2025. Grant applicants include: ORGANIZATION NAME AMOUNT REQUESTED RECOMMENDED AMOUNT ATTACHMENT The Art Spread $4,600 $0 A Backhausdance $4,000 $4,000 B Balboa Island Improvement Association (BIIA) $3,000 $3,000 C Baroque Music Festival, CdM $5,500 $4,000 D Emerald Magic Events, Inc. $38,000 $2,000 E Musica Transalpina $5,000 $0 F Newport Theatre Arts Center $10,000 $5,000 G Pacific Chorale $5,000 $3,500 H Pacific Symphony $5,000 $5,000 I South Coast Repertory $5,000 $3,500 J TOTAL FUNDING $85,100 $30,000 NOTICING: The agenda item has been noticed according to the Brown Act (72 hours in advance of the meeting at which the City Arts Commission considers the item). ATTACHMENT K: FY 2024-25 Cultural Arts Grants – Ad Hoc Subcommittee Recommendations for Grant Approval ATTACHMENT L: Summary of Cultural Arts Grant Applications ATTACHMENT M: City Council Policy I-10 – Culture and Arts Grants 24 1 NEWPORT BEACH CITY ARTS COMMISSION 2024-25 CULTURAL ARTS GRANT APPLICATION (Applications must be typed or word-processed- you may reformat on the computer as long as it appears the same: i.e. use Times New Roman 12 point and the same pagination.) Popular Name of Organization Legal Name (if different) Federal Tax ID No. Mailing Address City Zip _____________________________________________________________________________________ Contact Name Telephone _____________________________________________________________________________________ Fax E-mail Web Site Geographical Area Served Have you received a City of Newport Beach Cultural Arts Grant before? ____ If so, when? ________ Year organization was founded Number of paid staff _____ # of active volunteers ___ ___ Total amount requested: (from request line of project budget) $ _________ Estimated number of people in Newport Beach that the proposed project(s) will serve: _______10 The Art Spread Art Spread 3843 S Bristol Street #270 Santa Ana 92704 Nadin Said 951-973-1064 hello@theartspread.org theartspread.org Orange County 2020 No 10 25 85-0576857 $77$&+0(17$ 25 2 CULTURAL ARTS GRANT APPLICATION 2. Identify and describe why there is a need in the Newport Beach Community for your proposed project/program. Include a quantitative description of the need and on what you based your findings (i.e. “Based on a study done by the PTA, there are one hundred children in the 4th-6th grades at Newport Elementary who have had no training with musical instruments.” ) Describe how you have determined that your organization is the best organization for the proposed project/program. %ULHIO\GHVFULEHEHORZ\RXURUJDQL]DWLRQ VSXUSRVHPLVVLRQDQGJRDOV 7KH$UW6SUHDGLVDFQRQSURILWRUJDQL]DWLRQWKDWOHDGVDUWLVWVZKRH[SHULHQFHDGYHUVLW\WRVXFFHVV DQGWUDQVIRUPVFRPPXQLWLHVWKURXJKDUW7KURXJKLWVZRUN7KH$UW6SUHDGXSOLIWVVSDFHVSODFHVDQG SHRSOH7KHYLEUDQWRQOLQHJDOOHU\XSOLIWVVSDFHVE\RIIHULQJSDWURQVKLJKTXDOLW\DUWZRUNWKH\FDQFROOHFWRQ DQ\EXGJHW7KH$UW6SUHDGXSOLIWVDUWLVWVZLWKPHQWDOLOOQHVVSK\VLFDOGLVDELOLWLHVDQGVRFLDOEDUULHUVE\ SURYLGLQJVXSSRUWDQGVHUYLFHVWKDWKHOSWKHPDGYDQFHWKHLUFDUHHUVJDLQQHZVNLOOVDQGH[SRVXUHDQGHDUQ ILQDQFLDOVWDELOLW\7KH$UW6SUHDGXSOLIWVFRPPXQLWLHVVHUYLQJKXQGUHGVRIUHVLGHQWVLQ2UDQJH&RXQW\E\ RIIHULQJIUHHH[KLELWLRQVDQGZRUNVKRSVWRHVWDEOLVKKHDOWK\FUHDWLYHRXWOHWVIRUSHRSOHWROHDUQDERXWWKH WKHUDSHXWLFSRZHURIDUW'XULQJWKHVHIUHHH[KLELWLRQVDQGZRUNVKRSVOLIHORQJVXSSRUWLYHUHODWLRQVKLSVDUH FUHDWHGWKDWDOORZPHPEHUVRIWKHFRPPXQLW\WRIHHOFRQQHFWHGHPSRZHUHGDQGHGXFDWHGLQDUWVDQG FXOWXUH 1HZSRUW%HDFKLVNQRZQIRUIHDWXULQJWKHPRVWH[TXLVLWHDQGXQLTXHDUWWRWKHFRPPXQLW\3DUWRIWKDW FRPHVIURPWKHFRPPXQLW\¶VSDVVLRQDQGGHVLUHIRUZDQWLQJWROHDUQDERXWDQGFROOHFWDUWZRUNWKDW WUDQVIRUPVWKHLUVSDFHV$FFRUGLQJWR$UWV2&RUJ1HZSRUW%HDFKKDVRYHUDUWUHODWHGEXVLQHVVHV%\ XQGHUVWDQGLQJWKHOHYHORIFRPPLWPHQWDQGLQWHUHVWLQWKHDUWVWKDW1HZSRUW%HDFKKDVVKRZQ7KH$UW 6SUHDGLVDEOHWRFDUHIXOO\FXUDWHDQHYHQWWKDWZLOOVHUYHRYHUFRPPXQLW\PHPEHUVWKURXJKDQ H[KLELWLRQDQGZRUNVKRSH[WUDYDJDQ]D$VSDUWRIWKHH[KLELWLRQDUWZRUNIURPDFURVVWKHZRUOGZRXOGEH EURXJKWWR1HZSRUW%HDFKDQGGLVSOD\HGIRUVDOHDOORZLQJHDFKSLHFHWRWHOODSURIRXQGVWRU\RI RYHUFRPLQJDGYHUVLW\LQVSLULQJLWVYLHZHU,QDGGLWLRQUHFRJQL]LQJWKDWWKH1HZSRUW%HDFKFRPPXQLW\KDV DGHVLUHWRH[SHULHQFHWKHSURFHVVRIFUHDWLQJPHDQLQJIXODQGDHVWKHWLFDUWZRUNWKHIUHHZRUNVKRSVZRXOG SURYLGHJXLGDQFHPDWHULDOVDQGHQWHUWDLQPHQWLQGHVLJQLQJIXQFWLRQDODUWSLHFHV$VSDUWRIWKHFUHDWLYH ZHOOQHVVH[SHULHQFHWKLVHYHQWZRXOGDOVRIHDWXUHFRPSOLPHQWDU\XQLTXHEUHDWKH[HUFLVHVDQGD\RJD ZRUNVKRSOHGE\UHQRZQORFDODUWLVW$]DGHK6DUYL 7KH$UW6SUHDGKDVWKHNQRZOHGJHVWDIIYROXQWHHUVDQGSURJUDPKLVWRU\H[SHULHQFHWRVXFFHVVIXOO\FXUDWH DQLPSDFWIXOHYHQWIRUWKH1HZSRUW%HDFKFRPPXQLW\1HZSRUW%HDFKLVDYLEUDQWFRDVWDOFLW\ZLWKD WKULYLQJFXOWXUDOVFHQHKRPHWRRYHUUHVLGHQWVDQGVHHVPLOOLRQVRIYLVLWRUVDQQXDOO\$FFRUGLQJWR $UWV2&1HZSRUW%HDFK0DVWHU$UWVDQG&XOWXUH3ODQSHUFHQWRI1HZSRUW%HDFKUHVLGHQWVKDYH H[SUHVVHGDUWLVYHU\LPSRUWDQWLQWKHLUOLYHV1HDUO\SHUFHQWDUHVHHNLQJDUWVDQGFXOWXUHHYHQWVDQG FODVVHVWLPHVSHU\HDU:LWKDSSUR[LPDWHO\ILYHDUWJDOOHULHVFXUUHQWO\ORFDWHGLQ1HZSRUW%HDFKWKH QHHGVRIWKHFRPPXQLW\WREHHGXFDWHGDQGLQVSLUHGE\DUWKDVQRWFXUUHQWO\EHHQIXOILOOHG%ULQJLQJDQ LPPHUVLYHDUWH[SHULHQFHWR1HZSRUW%HDFKWKDWFRPELQHVYLVXDODUWVILQDQFLDOJURZWKIRUDUWLVWVDQG RSSRUWXQLWLHVIRUFRPPXQLW\PHPEHUVWRFUHDWHZLOOVHUYHWKH&LW\¶VQHHGVDQGDUWLVWLFGHVLUHV+DYLQJ FXUDWHGDVXFFHVVIXOH[KLELWLRQLQ/LGRWKDWZHOFRPHGRYHUJXHVWVDQGIHDWXUHGRYHUDUWSLHFHV7KH $UW6SUHDGLVWKHEHVWRUJDQL]DWLRQWRSURYLGH1HZSRUW%HDFK¶VDUWVDQGFXOWXUHOLIHVW\OHDQXQIRUJHWWDEOH H[SHULHQFH 26 3 3. Describe the specific project/program that will be funded by a Cultural Arts Grant. Include how the proposed project/program will be implemented and outline a schedule or project timeline, with planned dates and locations. Identify individuals and groups involved, particularly artists and performers, and describe their roles and responsibilities. Describe the background and qualifications of your organization and key personnel to be involved in the program. Remember: the City funds projects and programs only - not operating expenses. These projects and programs must promote community involvement and awareness of the arts in Newport Beach. Is this a new_____ or existing _[__ _ project/program? %H\RQG$HVWKHWLFVLVDIUHHIDPLO\IULHQGO\FRPPXQLW\HYHQWGHVLJQHGWRFHOHEUDWHFUHDWLYLW\ZHOOEHLQJ DQGWKHVSLULWRIWKH&LW\RI1HZSRUW%HDFK7KLVHYHQWEULQJVWRJHWKHUDUW\RJDDQGFRPPXQLW\ SDUWQHUVKLSVWRVKRZKRZDUWLVHVVHQWLDOWRWKH1HZSRUW%HDFKFRPPXQLW\DQGLWVZHOOEHLQJ(QJDJLQJ ZRUNVKRSVZLOOLQWURGXFHSDUWLFLSDQWVWRIUHVKSHUVSHFWLYHVRQDUWPDNLQJWRLPSURYHWKHLUOLYHVDQGWKHOLYHV RIRWKHUV 6KRZFDVHG$UWZRUN 3URIRXQGDUWIURPORFDODQGLQWHUQDWLRQDODUWLVWVZLOOEHGLVSOD\HGIRUVDOHDWSULFHVWKDWPDNHDUWDFFHVVLEOH IRUWKHHQWLUH1HZSRUW%HDFKFRPPXQLW\ %H\RQG$HVWKHWLFVZLOOIHDWXUHWKUHHLQWHUDFWLYHZRUNVKRSVOHGE\WDOHQWHGDUWLVWVDFWLYHLQWKHORFDO FRPPXQLW\7KHVHZRUNVKRSVDUHGHVLJQHGWREHDFFHVVLEOHWRHYHU\RQHUHJDUGOHVVRIDUWLVWLFH[SHULHQFH HQFRXUDJLQJSDUWLFLSDQWVWRH[SORUHWKHLUFUHDWLYLW\ 0L[HG0HGLD$UW:RUNVKRS 7KLVZRUNVKRSZLOOEHOHGE\DORFDO2UDQJH&RXQW\DUWLQVWUXFWRUDQGWKHUDSLVWZKRZLOOJXLGHSDUWLFLSDQWV WKURXJKWKHSURFHVVRIWKHUDSHXWLFDUWXVLQJPL[HGPHGLDWHFKQLTXHV$WWHQGHHVZLOOKDYHWKHRSSRUWXQLW\WR H[SHULPHQWZLWKGLIIHUHQWPDWHULDOVWH[WXUHVDQGVW\OHV$OOQHFHVVDU\VXSSOLHVZLOOEHSURYLGHGIUHHRI FKDUJHHQVXULQJWKDWHYHU\RQHFDQIXOO\HQJDJHLQWKHFUHDWLYHSURFHVV )XQFWLRQDO$UW:RUNVKRS $ORFDO2UDQJH&RXQW\DUWLVWZLOOOHDGWKLVKDQGVRQVHVVLRQIRFXVLQJRQFUHDWLQJIXQFWLRQDODUWSLHFHVOLNH FRDVWHUVPDJQHWVERRNPDUNVDQGRWKHUHYHU\GD\XVHLWHPV3DUWLFLSDQWVZLOOOHDUQKRZWRPDNHSUDFWLFDO DUWWRHQKDQFHWKHLUKRPHGHFRU)UHHVXSSOLHVZLOOEHDYDLODEOHIRUDOOSDUWLFLSDQWV <RJDDQG&UHDWLYLW\:RUNVKRS 7KLVZRUNVKRSZLOOEHOHGE\DORFDO2UDQJH&RXQW\UHVLGHQWZKRLVERWKDQDUWLVWDQGDFHUWLILHG\RJD LQVWUXFWRU7KHVHVVLRQZLOOFRPELQHDUWZLWKZHOOQHVVIRFXVLQJRQVWUHVVUHOLHIVHOIUHIOHFWLRQDQGPHQWDO KHDOWK7KURXJKJXLGHG\RJDH[HUFLVHVSDUWLFLSDQWVZLOOFUHDWHPHQWDOVSDFHIRULQVSLUDWLRQDQGFUHDWLYLW\ &RPPXQLW\(QJDJHPHQW /RFDO6XSSRUW %H\RQG$HVWKHWLFVLVGHGLFDWHGWRHVWDEOLVKLQJFRQQHFWLRQVZLWKLQWKHFRPPXQLW\E\KLJKOLJKWLQJDQG VXSSRUWLQJORFDO1HZSRUW%HDFKEXVLQHVVHV7KURXJKRXWWKHHYHQWVPDOOEXVLQHVVHVIURPWKHDUHDZLOO SURYLGHDSSHWL]HUVGHVVHUWVDQGUHIUHVKPHQWVWKDWVKRZFDVH1HZSRUW¶VFXOLQDU\FXOWXUH7KLVDSSURDFKQRW RQO\VXSSRUWVORFDOYHQGRUVEXWDOVRLQWURGXFHVDWWHQGHHVWRWKHYLEUDQWIRRGVFHQHRI1HZSRUW%HDFK 27 &ROODERUDWLRQ 9HQXH 7KHHYHQWZLOOEHKRVWHGDW1HZSRUW%HDFK&LYLF&HQWHU&RPPXQLW\5RRP7KHHYHQWZLOOEHLQFROODERUDWLRQ ZLWKORFDORUJDQL]DWLRQVOLNH9LOODJHVRI&DOLIRUQLD3XHEORVDPRQJRWKHUV%\XWLOL]LQJWKHFRPPXQLW\FHQWHU DQGZRUNLQJZLWKWKHVHRUJDQL]DWLRQV%H\RQG$HVWKHWLFVEULQJVYDOXDEOHUHVRXUFHVHQJDJLQJH[SHULHQFHV DQGFUHDWLYHRSSRUWXQLWLHVWRWKHDWWHQGHHVLQFOXGLQJPHPEHUVLQQHHGRIVWUHVVUHGXFWLRQDQGFUHDWLYH LQVSLUDWLRQ 7KRXJKWIXOSDUWQHUVKLSVZLWKOLNHPLQGHGRUJDQL]DWLRQVZLOOIXUWKHUWKLVSURMHFW¶VLPSDFWDQGVHUYHDJUHDWHU QXPEHURI1HZSRUW%HDFK¶VUHVLGHQWV7KH$UW6SUHDGKDVVXVWDLQHGDVWURQJUHODWLRQVKLSZLWK9LOODJHVRI &DOLIRUQLDDYDOXHG2UDQJH&RXQW\WHDPRIOLFHQVHGWKHUDSLVWVWKDWKDYHKDGWKHLUGRFXPHQWDU\ILOPIHDWXUHG DWWKH1HZSRUW%HDFK)LOP)HVWLYDODORQJVLGHRQHRI7KH$UW6SUHDG¶VDUWLVWV9LOODJHVRI&DOLIRUQLDZLOO ZRUNDORQJVLGH7KH$UW6SUHDGRQWKLVSURMHFWWRSURYLGHWKHLUH[SHUWLQVLJKWRQWKHWKHUDSHXWLFDQGHFRQRPLF EHQHILFLDOYDOXHRIDUWWKDWJRHVEH\RQGDHVWKHWLFV $IIRUGDEOH$UW5DIIOH $QH[FLWLQJIHDWXUHRIWKHHYHQWLVWKHDIIRUGDEOHDUWUDIIOHZKHUHFRPPXQLW\PHPEHUVFDQSXUFKDVHWLFNHWV IRUDQDIIRUGDEOHSULFHRI7KHUDIIOHZLOOIHDWXUHDVHOHFWLRQRIRULJLQDODUWZRUNFUHDWHGE\ERWKORFDODQG LQWHUQDWLRQDODUWLVWVLQFOXGLQJZDWHUFRORUDQGDFU\OLFSDLQWLQJVPL[HGPHGLDFROODJHVDQGWKUHHGLPHQVLRQDO DUWSLHFHV7KLVLQLWLDWLYHSURYLGHVDQRSSRUWXQLW\IRUWKHSXEOLFWRRZQPHDQLQJIXODUWWKDWPLJKWRWKHUZLVHEH RXWRIUHDFK3URPRWLQJDFFHVVLELOLW\UHLQIRUFHV7KH$UW6SUHDG¶VYLVLRQRIVKDULQJDUW¶VWUDQVIRUPDWLYHSRZHU WRHYHU\RQHWRLPSURYHYLHZHUV¶TXDOLW\RIOLIH /RQJWHUP,PSDFW %H\RQG$HVWKHWLFVVHHNVWRPDNHDODVWLQJLPSDFWRQIXWXUHJHQHUDWLRQVE\LQVWLOOLQJFUHDWLYHVNLOOVDQG SURYLGLQJRXWOHWVWRLPSURYHPHQWDOKHDOWKDOODWORZWRQRFRVWWRWKHFRPPXQLW\7KURXJKKDQGVRQ ZRUNVKRSVLQWHUDFWLYHH[SHULHQFHVDQGDIRFXVRQZHOOQHVVWKHHYHQWDLPVWRLQVSLUHSDUWLFLSDQWVWRFRQWLQXH WKHLUDUWLVWLFMRXUQH\DQGLQYHVWLQWKHLUORFDOFXOWXUH (YHU\DVSHFWRI%H\RQG$HVWKHWLFVLVGHVLJQHGWROHDGSDWURQVDQGWKHFRPPXQLW\EDFNWR1HZSRUW%HDFK FUHDWLQJODVWLQJUHODWLRQVKLSVEHWZHHQORFDOEXVLQHVVHVDUWLVWVDQGUHVLGHQWV7KLVHYHQWLVQRWMXVWD FHOHEUDWLRQRIDUWDQGFXOWXUHLWLVDFDWDO\VWIRUHFRQRPLFDQGVRFLDOJURZWKZLWKLQWKHFLW\HPSRZHULQJWKH FRPPXQLW\WRFUHDWHFRQQHFWDQGWKULYH 2WKHU.H\,QGLYLGXDOV &UHDWLYH'LUHFWRU5DZDQ,WD'LD]LVDQDUWLVWZKRKROGVD0DVWHURI6FLHQFHLQ$UFKLWHFWXUHDQG'HVLJQ6KH EHFDPHDQDUWLVWDIWHUDWUDJLFDFFLGHQWZKHUHVKHZDVVWUXFNE\DFDUDVDSHGHVWULDQ7XUQLQJWRDUWIRUWKH ILUVWWLPHLQKHUDUWZRUNEHFDPHDVHQVDWLRQWKDWZDVH[KLELWHGZRUOGZLGHLQFOXGLQJ1HZ<RUN&LW\ ,WDO\&DOLIRUQLD&KLFDJRDPRQJPDQ\RWKHUORFDWLRQV6KHKDVFXUDWHGRYHUZRUNVKRSVH[KLELWLRQVDQG DUWHYHQWVWKDWKDYHDOOEHHQZHOODWWHQGHGDQGUHFRJQL]HG 0DQDJLQJ'LUHFWRU1DGLQ6DLGKROGVD-XULV'RFWRUDQGLVZHOONQRZQLQWKH2UDQJH&RXQW\FRPPXQLW\%\ FRPELQLQJKHUDGYRFDF\VNLOOVZLWKKHUSDVVLRQDQGGHVLUHWRVKDUHWKHWUDQVIRUPDWLYHSRZHURIDUWVKHKDV DOVRVXFFHVVIXOO\KRVWHGFUHDWHGGHVLJQHGDQGEHHQLQYROYHGLQSODQQLQJRYHUHYHQWVRYHUWKHODVW \HDUVWKDWKDYHEHHQVXFFHVVIXOLQVHUYLQJWKHQHHGVRIFRPPXQLWLHV7KHVHHYHQWVKDYHLQFOXGHGDUW H[KLELWLRQVDQGZRUNVKRSHYHQWVIRUFLWLHVOLNH&RVWD0HVDDQG6DQWD$QD 28 0DULQD%UDII/0)7LVDQHPSDWKHWLFGLUHFWRUFOLQLFLDQDQGOLFHQVHGWKHUDSLVWZKRDOVRVHUYHVRQ7KH$UW 6SUHDG¶VERDUG+HUNQRZOHGJHRIWKHUDSHXWLFDUWUHOLHIFRPELQHGZLWKLPSURYLQJFKLOGUHQ¶VFRJQLWLYH DELOLWLHVLQ2UDQJH&RXQW\KDYHHIIHFWLYHO\LQIOXHQFHG7KH$UW6SUHDGWRUHFRJQL]HWKHWKHUDSHXWLFUHOHDVHDUW SURYLGHV :LWKDEDFNJURXQGLQILQDQFHDQGEXVLQHVVPDUNHWLQJ6DQGUD%D\RXGKDVVXFFHVVIXOO\DGYLVHGODUJH FRUSRUDWHFRPSDQLHVRQILQDQFHDQGPDUNHWLQJVWUDWHJLHV%ULQJLQJWKDWH[SHULHQFHWR7KH$UW6SUHDGVKH HQVXUHVWKHODUJHVWQXPEHURIFRPPXQLW\PHPEHUVDUHVHUYHGZKLOHVWD\LQJFRPPLWWHGWRTXDOLW\ 7KHVHDUHRQO\KLJKOLJKWVRIWKHNH\SHUVRQQHOZKLOHWKHUHPDLQGHUDUHGHWDLOHGLQDVHSDUDWH3')SURYLGHG ZLWKWKLVVXEPLVVLRQ ,QVXPPDU\%H\RQG$HVWKHWLFVZLOOIHDWXUHWKUHHZRUNVKRSVOHGE\HVWHHPHGDUWLVWVWKDWZLOOEHIUHHWRWKH SXEOLFVKRZFDVHDUWZRUNIURPRYHUWHQLQWHUQDWLRQDODUWLVWVWKDWZLOOEHDYDLODEOHWRFROOHFWRIIHUILIWHHQ H[FLWLQJUDIIOHSUL]HVDQGVHUYHRYHUFRPPXQLW\PHPEHUVZLWKFRPSOLPHQWDU\IRRGDQGEHYHUDJH 7LPHOLQH 3ODQQLQJZRXOGRFFXULQ)HEUXDU\ZLWKDQHYHQWVFRPPLWWHHPHHWLQJWRRUJDQL]HNH\SHUVRQQHODQG UHVHUYHYHQXHVSDFH %\)HEUXDU\YHQXHVKRXOGEHUHVHUYHGIRUHYHQWZLWKGHSRVLWSDLG9HQXHZLOOEH1HZSRUW%HDFK &LYLF&HQWHUFRPPXQLW\URRP 0DUFKWKURXJK0D\NH\DUWLVWVDQGZRUNVKRSLQVWUXFWRUVZLOOEHVHOHFWHG0DWHULDOVDQGVXSSOLHVIRU HYHQWZLOOEHSXUFKDVHG)XQGUDLVLQJHIIRUWVZLOODOVREHJLQIRUHYHQWGXULQJWKLVWLPHE\VHHNLQJ VSRQVRUVKLSGRQDWLRQVLQNLQGDQGPRQHWDU\HWF 0D\WKURXJK2FWREHUWKHLWLQHUDU\ZLOOEHFUHDWHGDQGSRVWHGZKLOHPDUNHWLQJORFDOO\WKURXJK MRXUQDOVRQOLQHSXEOLFDWLRQVVRFLDOPHGLDHWF3KRWRJUDSKHUZLOOEHVHOHFWHG/RFDOEXVLQHVVHVWRFDWHUIRRG DQGEHYHUDJHZLOOEHFRQWDFWHG 2FWREHUHYHQWZLOOUXQIURPSP6HWXSZLOOEHJLQDWDPDQGWHDUGRZQZLOOEH FRPSOHWHGE\SP 29 4. Define or describe the segment of the population in Newport Beach that you intend to serve by your project/program. Include such things as age, location, numbers served, etc. 7KH1HZSRUW%HDFKSRSXODWLRQLQWHQGHGWREHVHUYHGDUHFKLOGUHQDERYHWKHDJHRIWHQWKURXJKDGXOWVRI DOODJHV(YHU\DWWHQGHHZLOOEHJXLGHGDVQHFHVVDU\DQGQRSUHUHTXLVLWHVNLOOVDUHUHTXLUHG)DPLOLHVRI HYHU\FXOWXUHDQGEDFNJURXQGDUWFROOHFWRUVDQGHQWKXVLDVWVDQGDUHWLUHHGHPRJUDSKLFZLOOEHVHUYHGE\ WKHHYHQW¶VSURJUDPV7KHYHQXHLVGHVLJQHGWRKRVWDQGDOORZRYHUSHRSOHWRLQGXOJHLQDQLPPHUVLYH DUWH[SHULHQFHLQ1HZSRUW%HDFK5HVLGHQWVRI1HZSRUW%HDFKZKRDWWHQGZLOOUHFHLYHDIUHHDUWDQG ZHOOQHVVFDUHSDFNDJHWKDWLQFOXGHVDUWVXSSOLHVDQGZHOOQHVVUHVRXUFHVZKLOHVXSSOLHVODVW)URPWKHWRWDO QXPEHURIDWWHQGHHV7KH$UW6SUHDGH[SHFWVWREH\HDUROGVWREH\HDUROGV WREH\HDUROGVDQGIRUDJHVDQGROGHU:LWKWKHORFDWLRQEHLQJDWWKH1HZSRUW%HDFK&LYLF &HQWHUDOOUHVLGHQWVRI1HZSRUW%HDFKZLOOEHDEOHWRDWWHQG7KHUHLVDPSOHSDUNLQJDQGWKHEXLOGLQJLV HDV\WRORFDWHQH[WWR)DVKLRQ,VODQGPDOO,WLVDOVRFORVHWRSXEOLFWUDQVLWDUHDVDOORZLQJUHVLGHQWVDQG SDWURQVWRDWWHQGZKRGRQRWKDYHDYHKLFOH 30 5. Complete the project budget form. Address only the budget for the specific project, not your annual operating budget. For multi-project proposals, please duplicate and fill out a budget for each project. Please annotate the budget at the bottom if there are details (such as a breakdown of personnel or a marketing budget) critical to the proposal. PROJECT BUDGET Funding from the City of Newport Beach Funding from Other Sources EXPENSES-Personnel Artistic Administrative Technical Production EXPENSES-Operating Facility Expense/Space Rental Marketing Production/Exhibition Expense Touring/Presentation Expense Educational Materials Transportation Equipment Other (if greater than 10%, annotate below) GRAND TOTAL 6. Describe the expected quantifiable outcomes of your project/program and how you will evaluate the results. Be very specific in addressing the ways that you will determine that your project/program met the needs that you identified and accomplishes the goals you set out to achieve (i.e. you provide 50 hours of musical instruction and instruments to the 100 children at Newport Elementary school as measured by music store rental receipts and logs of instructors.) $ $4,600 7KLVHYHQWKDVVHYHUDOJRDOVLQFOXGLQJWKHTXDQWLWDWLYHDQGTXDOLWDWLYHLPSDFWRQFRPPXQLW\ZRUNVKRS HQJDJHPHQWIXQGUDLVLQJDQGDUWVDOHV 7RVWDUWWKHHYHQWVKRXOGKDYHRUPRUHDWWHQGHHV7KHQXPEHURIDWWHQGHHVZLOOEHUHFRUGHGWKURXJKD FKHFNLQZLWK7KH$UW6SUHDG¶VHYHQWKRVW8QGHUVWDQGLQJKRZWKHDWWHQGHHOHDUQHGRIWKHHYHQWZLOODOVREH UHFRUGHGIRUIXWXUHXVHUHJDUGLQJSURPRWLRQDOHIIRUWVDQGPDUNHWLQJ $WWKHHYHQWWKHTXDQWLWDWLYHJRDOIRUWKHWKUHHZRUNVKRSVLVWRKDYHSDUWLFLSDQWV(DFKZRUNVKRSZLOO EHXQGHUPLQXWHVDOORZLQJDWWHQGHHVWRURWDWHDQGH[SHULHQFHDOOWKHZRUNVKRSLIGHVLUHG7KHQXPEHURI ZRUNVKRSDWWHQGHHVZLOOEHUHFRUGHGWKURXJKDVLJQLQVKHHWVWDWLRQHGDWHDFKZRUNVKRS9HUEDODQGRU ZULWWHQIHHGEDFNZLOODOVREHUHTXHVWHGDWWKHFRQFOXVLRQRIWKHZRUNVKRSWRVKDUHWKHYDOXHDQGLPSDFW 7KHHYHQWZLOOVKRZFDVHDSSUR[LPDWHO\DUWSLHFHVGLVSOD\HGIRUVDOHLQDGGLWLRQWRDQDIIRUGDEOHDUW UDIIOHRIIHULQJSUL]HVDQGDOLYHDXFWLRQSUHVHQWLQJKLJKYDOXHLWHPV,QWRWDODWOHDVWDUWSLHFHVFDQ EHFROOHFWHGE\PHPEHUVRIWKH1HZSRUW%HDFKFRPPXQLW\ZKLFKDOORZVWKHLQIOXHQFHRIWKHDUWWRODVW ORQJDIWHUWKHFRQFOXVLRQRIWKHHYHQWZKLOHVXSSRUWLQJDUWLVWV 31 :KHQOHDYLQJWKHHYHQWDTXLFNVXUYH\ZLOOEHSURYLGHGWRWKHDWWHQGHHVZKRFDQYHUEDOO\UHVSRQGRU DQVZHULQZULWLQJ7KHVXUYH\ZLOOLQFOXGHDWPRVWWZRTXHVWLRQVWKDWDVN :RXOG\RXUHWXUQWRWKLVHYHQWQH[W\HDULQ1HZSRUW%HDFK" :KDWGLG\RXHQMR\WKHPRVW" 7KURXJKWKLVHYHQWDQGWRFRQWLQXHWRVHUYHWKH1HZSRUW%HDFKFRPPXQLW\LQWKHIXWXUHWKH IXQGUDLVLQJJRDOZLOOEHIURPDUWVDOHVGRQDWLRQVUDIIOHWLFNHWVOLYHDUWDXFWLRQHWF$OO IXQGUDLVLQJHIIRUWVZLOOEHGRFXPHQWHGDQGXVHGLQSDUWWRKRVWWKHQH[W1HZSRUW%HDFKHYHQW $IWHUWKHHYHQWDPDQGDWRU\PHHWLQJIRUVWDIIDQGYROXQWHHUVZLOOEHFRQGXFWHG7KLVPHHWLQJZLOOEH RSHQWRWKHSXEOLFIRUIHHGEDFNDQGZLOOGLVFXVVWKHVXFFHVVRIWKHHYHQWDQGKRZLWFDQFRQWLQXHWR LPSURYH7KLVZDVSUHYLRXVO\LPSOHPHQWHGDWSULRUHYHQWVDQGKDVEHHQYHU\XVHIXOWRSUHSDUHIRUWKH QH[WHYHQWDQGXQGHUVWDQGWKHFRPPXQLW\¶VQHHGVEHWWHU 32 7. Attachments Requested Please do not send material in excess of what is requested; it will not be seen by the City Arts Commission. x A list of Board Members and their affiliations x A recent list of individuals, corporations and foundations that provide organizational support- not to exceed one page. x If you are a 501(c) (3) organization attach a copy of your IRS determination letter (or your fiscal agent’s) indicating tax exempt status. x One brochure and/or one press clipping. Do not send photos, videos, CDs or any other extraneous material. It will not be presented to the City Arts Commission. 8. Please complete this operating budget form for 2024/25 and 2025/26. This is not the project/program budget for which you are applying, but your overall organizational budget. You may annotate at the bottom if there are details critical to the proposal. OPERATING BUDGET 2024/25 Budget (current) 2025/26 Budget (projected) I. Income (cash only) Contributed Earned Total Income II. Expenses Program General and Administrative Marketing and Development Total Expenses III. Operating Surplus/Deficit (Income minus Expenses) IV. Fund Balance at Beginning of Year V. Accumulated Surplus (Deficit) (Add lines III and IV) VI. In-Kind Contributions (attach schedule if greater than 10% of total income) 9. I verify that the information submitted in this application is true and correct to the best of my knowledge. Name ____________________________________ Title ____________________________________ Signature __________________________________________ Date ___________________________ 1DGLQ6DLG 0DQDJLQJ'LUHFWRU__________________ __________________ 33 Managing Director | BOD *ZIRXXEǺCreative Director | BOD *ZIRXXEǺ`'4)*ZIRXXEǺ`'4)*ZIRXXEǺ`'4) The Art Spread Oversees content, mentors and guides artists to success, and supervises team members. Oversees and implements business strategies, works with the community to create events, and seeks funding and donations. Relates to The Art Spread’s mission by having traveled to multiple countries and seeing EVXƶWMRǼYIRGISRGYPXYVIERH well being. Dedicated to The Art Spread’s inclusive mission for everyone experiencing physical challenges and EQTPMǻIWXLIZSMGIWSJXLI unheard and marginalized. Has an appreciation for The Art Spread’s platform and enjoys the tools it creates for artists that allows them to spread inspiration to communities. Is glad to be a part of The Art Spread and uses her expertise to give back, stay involved with the community, and indulge her passion for art.34 Grant Editor Event Coordinator*ZIRXXEǺ Licensed Therapist | BOD*ZIRXXEǺ Therapist The Art Spread Is a student at California Polytechnic University and is passionate about giving back to the community through artistic means Edits and reviews The Art Spread’s grant applications to ensure clear and focused content. Coordinates the preparation leading up to the event in addition to organization on the day of the event. Is Passionate about The Art Spread’s mission is displayed MRLIVIǺSVXWXSWTVIEHXLI message through content creation. Is passionate in supporting The Art Spread’s mission to enhance wellness for both artists and the broader community through therapeutic art exercises. Is dedicated to helping reduce the stigma surrounding mental illness and increase access and awareness of art and the TVSJSYRHFIRIǻXWMXTVSZMHIW for one’s well-being.35 36 Letter 4425 (Rev. 8-2021) Catalog Number 52256W Department of the Treasury Internal Revenue ServiceTax Exempt and Government EntitiesP.O. Box 2508 Cincinnati, OH 45201 THE ART SPREAD 3411 S MAIN STREET UNIT M SANTA ANA, CA 92707 Date: 10/30/2024 Employer ID number: 85-0576857 Form 990/990EZ/990-N required: Yes Person to contact: Name: Carla Kederis ID number: 4996476 Telephone: 877-829-5500 DearApplicant: In your letter datedMay 30, 2024, you requested a reclassification of foundation status as a publiccharity. Our records indicate you are classified as a privatefoundation. You claim you're erroneouslyclassified as a private foundation and are requesting correction of the error. Based on the information you provided, we determined you meet the requirements for classification as a public charity described in IRC Sections509(a)(1) 170(b)(1)(A)(vi)and updated our records. Because your tax-exempt status wasn't under consideration, you continue to be classified as an organization exempt from federal income tax under IRC Section 501(c)(3). This letter could help resolve questions on your foundation status. Keep it for your records. Sincerely, Stephen A. Martin Director, Exempt Organizations Rulings and Agreements 37 38 NEWPORT BEACH CITY ARTS COMMISSION 2024 -25 CULTURAL ARTS GRANT APPLICATION (Applications must be typed or word-processed- you may reformat on the computer as long as it appears the same: i.e. use Times New Roman 12 point and the same pagination.) Backhausdance Popular Name of Organization Backhaus Dance 05-0575068 Legal Name (if different) Federal Tax ID No. P. O. Box 5890 Mailing Address Orange 92863 City Zip Nancy Warzer-Brady 949-751-7874 Contact Name Telephone __none______________________nancy@backhausdance.org _ _____ _ www.backhausdance.org ____ Fax E-mail Web Site Newport Beach, Orange County, CA; Southern CA Geographical Area Served Have you received a City of Newport Beach Cultural Arts Grant before? _yes_ If so, when? __ 2024 __ Year organization was founded 2003 Number of paid staff _ 15 _ # of active volunteers __ _ 20 ___ Total amount requested: (from request line of project budget) $ 4,000.00 Estimated number of people in Newport Beach that the proposed project(s) will serve: _ _ 1,300 1 $77$&+0(17% 39 CULTURAL ARTS GRANT APPLICATION 1. Briefly describe below your organization’s purpose, mission, and goals. Overview Backhausdance, Orange County’s premiere contemporary dance company, was founded in 2003 by award-winning choreographer Jennifer Backhaus, Newport Beach resident and Chapman University dance faculty member. Over the past two decades, the company has grown into a nationally recognized leader in contemporary dance, highly regarded for its stunning performances, meaningful and inspiring education programs, and strong commitment to community engagement. Known for its artistic excellence, Backhausdance presents original works at theaters and outdoor spaces throughout Orange County including Sherman Library and Gardens in Corona del Mar, as well as throughout Southern California. At the heart of Backhausdance is a steadfast dedication to inclusivity, equity, and diversity—embracing all perspectives and ensuring that dance is accessible to people of all ages and abilities. With 13 part-time professional dancers, a part-time apprentice, 4 artistic and education staff members, a committed Board of Directors, and volunteers, the company continues to enrich lives through the transformative power of contemporary dance. We are proudly celebrating our 22nd year of creativity, growth, and community connection in 24-25. Since our beginning we have operated without a dedicated studio or office site. Mission, Purpose, and Goals The mission of Backhausdance is to inspire and engage diverse audiences with the vitality of contemporary dance—both as an art form and a means of creative expression. Backhausdance aims to expand the reach of contemporary dance in Newport Beach, Orange County, and beyond. Education is a critical part of our mission, with programs designed to introduce students to the beauty of contemporary dance, foster creativity, and build cultural understanding. We are dedicated to empowering the next generation of dancers by offering life-changing opportunities such as our annual three-week Summer Intensive, where we provide scholarships for teens, university-level students, and professionals.Through collaborations with schools, higher education institutions, community organizations, and arts venues, Backhausdance ensures high-quality, impactful arts experiences that unify and enrich our communities, advocating for “ dance every day for every body. ” . 2. Identify and describe why there is a need in the Newport Beach Community for your proposed project/program. Dance instruction is limited in Newport-Mesa Unified School District (NMUSD), leaving students without access to its many physical, social, and academic benefits and sparking their interest to consider further study in dance and the arts. Our program, Dance Expressions: Creativity and Choreography, provides over 150 middle and high school students the chance to have a unique opportunity to have an in-depth experience into the world of their own local professional contemporary dance company through workshops and performances. For most students, this is the first time seeing a contemporary dance performance in the school theater in the Newport Beach community. Additionally, with students performing in the Fall Choreography Showcase at Corona del Mar Middle/HS, families and friends of students have a broader, shared view of the impact and need for dance and cultural enrichment in Newport Beach. This program provides a vital, physical and creative outlet for teens as they are faced with numerous academic and social pressures, with many having increased anxiety, depression. By addressing gaps in arts education and cultural enrichment, Dance Expressions enhances the lives of Newport Beach residents and strengthens pride in the community. Research studies (Naional Dance Education Association) and numerous others reflect the positive connection between dance, psychological and cognitive outcomes. According to CDM dance director Morgan Beckman and BB High School dance teacher Cami Marseilles, “ Dance Expressions introduces students to contemporary dance techniques taught by their local professional company. It expands their college and career opportunities, builds confidence, and promotes well-being.” 2 40 3. Describe the specific project/program that will be funded by a cultural grant. Include how the proposed project/program will be implemented and outline a schedule or project timeline, with planned dates and locations. Identify individuals and groups involved, particularly artists and performers, and describe their roles and responsibilities. Describe the background and qualifications of your organization and key personnel to be involved in the program. Remember: the City funds only projects and programs- not operating expenses. These projects and programs must promote community involvement and awareness of the arts in Newport Beach. Is this a new _____ or existing __ X _ _ project/program? Backhausdance proposes to present Dance Expressions: Creativity and Choreography , an in-depth dance education partnership with three schools in Newport-Mesa Unified School District (NMUSD): Corona del Mar Middle/High School (CDM), Back Bay High School (BB) and Newport Harbor High School (NHHS), during September - December 2025. Dance Expression s offers a unique opportunity for over 150 Newport Beach teens to have an immersive educational experience working alongside Backhausdance professional dancers. Students will learn Backhausdance contemporary technique, choreography, composition, improvisation, partnering, movement vocabulary, and performance presentation. Backhausdance instructors, in collaboration with the students, will develop new choreography for the Fall 2025 Student Showcase performances at CDM for Newport Beach residents and the public, November 20-21, 2025. Dance Expressions participants will gain understanding on how to express their creativity, emotions, tell stories and communicate through dance while exploring career pathways into professions in the performing arts. Dance Expressions Workshops Schedule , September - December 2025 1. CDM: Tuesday, 9/8/25 - planning meeting with Morgan Beckman, Backhausdance artistic staff Total of 32 workshops, 75 minutes each, set choreography for student performances in November 2025 a. 9/16/25 - 10/9/25, 4 weeks, 16 workshops, Tuesdays & Thursdays, 9/16 & 9/18, 9/23 & 9/25, 9/30 & 10/2, 10/7 & 10/9, period 1, 8:30am-10am, Dance 3 (middle school) and period 3, 10:30am -12pm, Dance 2 (middle school, average 35 students per class b. 9/17/25 - 10/10/25, 4 weeks, 16 workshops, Wednesdays & Fridays, 9/17 & 9/19, 9/24 & 9/26, 10/1 & 10/3, 10/8 & 10/10, Dance 3 (high school), period 1, 8:30am-10am, Dance 2 (high school), period 3, 10:30am-12pm, average 30 students per class 2. BB: Planning with Cami Marseilles, 9/10/25. Two one-hour workshops for one class of 15 students in grades 10-12, Tuesday, 12/9 and Thursday, 12/11, period 3, 10:30am-11:30am 3. NHHS: Planning with Mackenzie Macfarland, 9/10/25. Two one-hour workshops for two classes of students in grades 10-12, 40 students per class, Wed., 1210, period 1, 8:30am-10am and 3, 10:15am-12pm. Dance Expressions Performances/Assemblies, September 2025 Held in the Sea King Theatre at CDM on Thursday, 9/25, 9am-10am and 10:15am- 1:15am, the entire Backhausdance company performs new repertory for our 25/26 Season with facilitated discussion by Jennifer Backhaus, artistic director, and Amanda Kay White, associate artistic director, to break down the dance movement phrases, production, lighting, costumes and musical elements, with question & answer session between dancers and audience. Invitations are sent to additional CDM, BB and NMUSD high schools with transportation provided by NMUSD. Additional guests include CDM administrators, NMUSD School Board members, Newport Beach Arts Commission and Backhausdance Board (many are Newport Beach residents). 4. Define or describe the segment of the population in Newport Beach that you intend to serve by your project/program. Include such things as age, location, numbers served, etc. D ance Expressions will serve 750+ students, grades 7 -12, ages 13-18, from CDM, BB, and NHHS, teachers, administrators, as well as over 600 audience members attending the Fall Showcase at CDM. Most students have had little to no involvement with a professional dance company or had the opportunity to see a contemporary/modern dance performance in Newport Beach. The experience will engage students’ critical thinking abilities and imaginations in a safe environment while they develop new artistic skills to balance their academic and socio-emotional stressors. Backhausdance professional teaching artists are skilled at working with students of all abilities to engage a diverse range of ages, skill levels and backgrounds. 3 41 6. Describe the expected quantifiable outcomes of your project/program and how you will evaluate the results. Be very specific in addressing the ways that you will determine that your project/program met the needs that you identified and accomplishes the goals you set out to achieve (i.e. you provide 50 hours of musical instruction and instruments to the 100 children at Newport Elementary school as measured by music store rental receipts and logs of instructors.) Dance Expressions: Creativity and Choreography aligns with California Department of Education standards for Dance, Physical Education, Universal Design for Learning (UDL), and Social-Emotional Learning (SEL). Expected outcomes include: ● Skill Development: 95% of participants will demonstrate understanding of contemporary dance technique including: movement vocabulary, improvisation, choreography, and teamwork, ● Engagement and Inspiration: 90% of participants will report increased self-confidence, creativity, appreciation for dance as an art form and new awareness of college and career opportunities. Program evaluation includes quantitative and qualitative methods to assess the residency's accomplishments and significance, providing over 45 hours of instruction to approximately 150 middle and high school students and performances to an additional 600+ high school students. Tools including daily attendance, online pre- and post-surveys, reflective discussions, and student essays will measure growth in technical skills, creativity, teamwork, confidence, and the joy of learning and performing. Feedback from students, educators, administrators, and parents will also reflect the overall impact of seeing a greater appreciation for dance as an art form and a possible career pathway. Teaching artists record daily notes to track progress and make refinements as needed. An artistic and educational team consisting of Jennifer Backhaus and Nancy Warzer-Brady (also a Newport Beach resident) collaborates closely with CDM, BB and NHHS educators along with Tamara Fairbanks, NMUSD visual and performing arts coordinator) to plan and ensure the program's success. Nancy Warzer-Brady coordinates the residency, scheduling and overseeing dancers/teaching artists, workshops and performances, to promote and reinforce strong community engagement and cultural benefit to the City of Newport Beach. 4 5. PROJECT BUDGET Funding from the City of Newport Beach Funding from Other Sources/In-Kind EXPENSES-Personnel Artistic $4,000.00 $4,000.00 Administrative $1,500.00 Technical Production $500.00 EXPENSES-Operating Facility Expense/Space Rental $500.00 Marketing $500.00 Production/Exhibition Expense Touring/Presentation Expense $300.00 Educational Materials $300.00 Transportation $1,000.00 Equipment $150.00 Other (if greater than 10%, annotate below) GRAND TOTAL $4,000.00 $8,750.00 42 7. Attachments Requested A list of Board Members and their affiliations ● A recent list of individuals, corporations and foundations that provide organizational support- not to exceed one page. ● If you are a 501(c) (3) organization attach a copy of your IRS determination letter (or your fiscal agent’s) indicating tax exempt status. ● One brochure and/or one press clipping. Do not send photos, videos, CDs or any other extraneous material. It will not be presented to the City Arts Commission. 8. Please complete this operating budget form for 2024/2025 and 2025/2026. This is not the project/program budget for which you are applying, but your overall organizational budget. You may annotate at the bottom if there are details critical to the proposal. OPERATING BUDGET 2024/25 Budget (current) 2025/26 Budget (projected) I. Income (cash only) Contributed 224,450 225,123 Earned 242,411 243,138 Total Income 466,861 468,261 II. Expenses Program 332,997 333,995 General and Administrative 70,875 71.087 Marketing and Development 52,540 52,697 Total Expenses 456,412 457,779 III. Operating Surplus/Deficit (Income minus Expenses) 10,449 10,482 IV. Fund Balance at Beginning of Year 0 0 V. Accumulated Surplus (Deficit) (Add lines III and IV) 0 0 VI. In-Kind Contributions (attach schedule if greater than 10% of total income) n/a n/a 9. I verify that the information submitted in this application is true and correct to the best of my knowledge. Name Nancy Warzer-Brady Title Director of Education and Community Engagement Signature Date January 10, 2025 5 43 Board of Directors, 2024-2026 Mike Kerr, Chairman Real Estate Developer Christopher Blank Attorney Sue and Jim Colombo Real Estate Joann Leatherby Arts & Community Philanthropist Benny Mor Corporate/Retail Alex Stimpson The Gerrit and Amy Cole Foundation Valerie Van de Zilver Real Estate Judy Whitmore Performer, Arts Philanthropist 24/25 Season photography by Sarah Delgado.On location in Newport Beach, Back Bay. P.O. Box 5890, Orange, CA 92863 | 949.751.7874| https://www.backhausdance.org/ 44 Cultural Arts Grant - Newport Beach City Arts Commission 2024-2025 Organizational Support: Individuals, Corporation, Foundation, Government, 2023-2024 Karen Adnams Karen Akashi Susan Anderson David Applebaum Leona Aronoff-Sadacca Jennifer Backhaus Paul Baez Anastasia Bartoli Robert Becker Jay Berger Jeannie Berryman Chris Blank and Josie Badeaux Kimberley Blank Craig Boardman Margaret Bodeau Jennifer Bonfil Rick Boxeth Alexander Brana Ellen Breitman Lorianne Bundnick Susan Casabella Jim Cigler Joe Cisneros City of Newport Beach City of Santa Ana Sue and Jim Colombo Cyrille Conseil Claudia Contreras Roberta "Bobbi" Cox Jackie D’Ambrosio Catherine Dickinson Liz Drolet Eugenia Esgalhado Farmers & Merchant Bank Foundation Robert Farnsworth Ralph & Lorraine Fish Barbara Foster Marianne Gastelum Kristina Goodfellow Ethan Gregory Lindsey Hager Clara Harnett Marc & Justin Harvey Eddie Herbert Jesse Hoggard Judi Imm Marica Pendjer John Miller Debbie Johnson Judy Joss Samuel Kelaher Bert Kelley Bentley & Mercedes Kerr Mike Kerr Debra Kerr-Orlick Joann Leatherby David Lewis Mary & Gary Lisenbee Genevieve and Matthew Macias Liz Maxwell Pat McAuley Dale Merrill Benny Mor Lori Murphy Kimberly Olmos Michael Olmos Giulio and Cheryl Ongaro Orange County Community Foundation Cyrus and Patrick Parker-Jeannette Dick Paulsen Sandy Pedersen Nemie Pollack Charles Rayfield Michael Regan Liliana Rodriguez Robert Romney Martha Ryan Tony and Tricia Sanchez Verylann Selby Sharron Shepard Sarah Shirley Jerry & Karen Southards Nancy & Rob Stewart The Gerrit and Amy Cole Foundation Kajsa Thuresson-Frary Chris Trela Bart van Aardenne Valerie and Peter Van de Zilver Jeff Verdon Nancy Warzer-Brady Sandra Waugh Suzanne Wessman Patty & Tom West W. Raymond White Judy and Wes Whitmore Lori Zucchino 45 46 47 48 49 50 51 "55"$).&/5$ 52 53 54 55 56 57 58 59 !)#"$&&+$&%" %%"! '&'$$&%$!&##&"! <<860.@6;:?9A?@/2@E<21;>C;>1<>;02??21E;A9.E>23;>9.@;:@520;9<A@2>.?8;:4.?6@ .<<2.>?@52?.9262A?2&692?!2C$;9.: <;6:@.:1@52?.92<.46:.@6;: .>;=A2 A?602?@6B.8;>;:.128 .> ,EFKB7H*7C;E<+H=7D?P7J?ED 7HEGK;)KI?9";IJ?L7BEHED7:;B)7H !%* (;=7B*7C;?<:?<<;H;DJ ";:;H7B/7N% *E #";D )7?B?D=::H;II ;>;:.128 .> ?JO 5?F 27OD;*EHC7D,H;I?:;DJ ,2:1C.>1?D20A@6B26>20@;> ---------------------------------------------------------------------------------- EDJ79J*7C; /;B;F>ED; P;D ;:M7H:I?9BEK: 9ECQM7OD;ADEHC7DL;H?PED D;JQ?D<E8C<9:C EH= >JJFI8C<9:C EH= ------------------------------------------------------------------------------------- "3 !C7?B 2;8.?J; ,H?C7H?BOEHED7:;B)7H*;MFEHJ;79>EJ>;H+H7D=;EKDJO9?J?;I7D:=H;7J;H.EKJ>;HD7B?<EHD?7 #;E=H7F>?97BH;7.;HL;: $7L;OEKH;9;?L;:7?JOE<*;MFEHJ;79>KBJKH7BHJI#H7DJ8;<EH;+%%<IEM>;D 4;7HEH=7D?P7J?EDM7I<EKD:;: *KC8;HE<F7?:IJ7<< <.>@@692E<79J?L;LEBKDJ;;HI- &;@.8.9;A:@>2=A2?@21<HECH;GK;IJB?D;E<FHE@;9J8K:=;J- - ?@69.@21:A9/2>;3<2;<826:!2C<;>@2.05@5.@@52<>;<;?21<>;720@?C688?2>B2- - $77$&+0(17' 60 '&'$$&%$!&##&"! H?;<BO:;I9H?8;8;BEMOEKHEH=7D?P7J?EDUIFKHFEI;C?II?ED7D:=E7BI />;C?II?EDE<J>;7HEGK;)KI?9";IJ?L7BEHED7:;B)7H)"J>;";IJ?L7B?IJEFH;I;DJ<EH ;L;HOED;?DJ>;9ECCKD?JO>?=>B;L;BFHE<;II?ED7B9ED9;HJIJ>7JFHECEJ;J>;H7D=;7D:8;7KJOE< 7HEGK;CKI?97J7<<EH:78B;FH?9;I?D?DJ?C7J;BE97BL;DK;IM?J>;:K97J?ED7B7IF;9JI />;)">7I>;B: 7I;H?;IE<9ED9;HJI?D&KD;<EHO;7HI7J.>;HC7D#7H:;DI7D:?D79EKIJ?97BBO7FFHEFH?7J;BE97B 9>KH9>;I %DJ>;)"I7M?JIJ>?H:>?=>;IJJ?9A;JI7B;I?DJ>;EH=7D?P7J?EDUI>?IJEHO +KH=E7B<EHJ>; J>I;7IED?D?IJE9EDJ?DK;7K:?;D9;7D:IKFFEHJ;H=HEMJ> />;JH7:?J?ED;IJ78B?I>;:8O,HE< KHJED'7HIED?D7D:97HH?;:ED8OJ>;";IJ?L7BUID:7HJ?IJ?9:?H;9JEH!B?P78;J>BKC;DIJE9A I?D9;M?BB9EDJ?DK;JEIKIJ7?D7D::;L;BEF9ECCKD?JO9EDD;9J?EDIJ>HEK=>7HEGK;CKI?9 *;M J>?IO;7HM;I;JKF7I;F7H7J;KHJED'7HIED)KI?9!:K97J?ED"KD:?D&KD;IEB;BOJE<KD:ED 97CFKI7HEGK;MEHAI>EFI7D:EJ>;H?DJ;H79J?L;CKI?979J?L?J?;I<EHOEKJ>>;B:M>?B;I9>EEBI7H;?D I;II?ED 2;>EF;J>7JM>;DJ>;I;EKJH;79>?D?J?7J?L;I8;=?D?DJ>;OM?BBH7?I;7M7H;D;IIE<J>; )"UI9ED9;HJI?D*;MFEHJ;79>7D:D;7H8O />?IO;7HUI";IJ?L7B&KD;<E9KI;IEDJ>;CKI?9E< 7HEGK;UIIKF;HIJ7H9ECFEI;HDJED?E1?L7B:??D9BK:?D=7H7H;EFFEHJKD?JOJE>;7HBKC;DIJE9AED>;H D:H;7#K7HD;H?L?EB?D?D $!""R9ED9;HJEII>;>7IDEJF;H<EHC;:7I7I;JI?D9; />;C7?D9ED9;HJ<EHJ>?I7FFB?97J?ED?IJ>;"?D7B;ED&KD;<;7JKH?D=J>;";IJ?L7B+H9>;IJH7LE97B7D: JHKCF;JIEBE?IJI7D:7IC7BB9>EHKI 1?L7B:?UI9;B;8H7J;: !H;:?I9EL;H;:?DJ>;B7J;I EH9>;IJH7BMEHAI7D:JMEE<>?IIJKDD?D=IEBELE?9;I;9KB7H97DJ7J7IFBKI>?I9EDJ;CFEH7HO(EJJ?UIF7HJ KD799ECF7D?;:LE97B!$'$"C7A;KFJ>;FHE=H7C 2;M?BBFHECEJ;.JK:;DJI#E<EH7HEGK;-KI> /?9A;JI<EHJEBE97BIJK:;DJI<EH7BB9ED9;HJIM?J>=;D;H7B7:C?II?EDJ?9A;JFH?9;I7L;H7=?D=;79> %:;DJ?<O7D::;I9H?8;M>OJ>;H;?I7D;;:6:@52!2C<;>@2.05;99A:6@E<EHOEKHFHEFEI;: FHE@;9JFHE=H7C %D9BK:;7GK7DJ?J7J?L;:;I9H?FJ?EDE<J>;D;;:7D:EDM>7JOEK87I;:OEKH<?D:?D=I ? ; S7I;:ED7IJK:O:ED;8OJ>;,/J>;H;7H;ED;>KD:H;:9>?B:H;D?DJ>;J>J>=H7:;I7J *;MFEHJ!B;C;DJ7HOM>E>7L;>7:DEJH7?D?D=M?J>CKI?97B?DIJHKC;DJI T ;I9H?8;>EMOEK>7L; :;J;HC?D;:J>7JOEKHEH=7D?P7J?ED?IJ>;"#EH=7D?P7J?ED<EHJ>;FHEFEI;:FHE@;9JFHE=H7C />;)"H;C7?DIJ>;EDBOFHE<;II?ED7BIEB;BO9B7II?97BCKI?9FH;I;DJ;H>;7:GK7HJ;H;:?D*;MFEHJ ;79>EHED7:;B)7H7D:EKHMEHA?I9EDJ?DK7BBOED=E?D=JE8K?B:KFEDEKH;N9;BB;DJJH79AH;9EH:E< I;HL?D=J>;BE97B9ECCKD?JO 2?J>7BB9ED9;HJI>;B:?DEHED7:;B)7H7D:*;MFEHJ;79>J>;)" J7A;II;H?EKIBOJ>;H;IFEDI?8?B?JOJEFHEL?:;F;H<EHC7D9;IJ>7J7H;7HJ?IJ?97BBOEKJIJ7D:?D=KFB?<J?D=7D: <KBBO799;II?8B;JE7BE97B7K:?;D9; 2;?D9BK:;9EDI?:;H7J?EDE<F>OI?97B799;II=;E=H7F>?9I ;DH?9>C;DJ;:K97J?ED7D:9EIJ7IM;BB7IEF;H7J?D=SB;7DT7:C?D?IJH7J?L;BOM>?B;>EB:?D=EKHI;BL;I CKI?9?7DI7D:I;7IED7BIJ7<<JE>?=>FK8B?9IJ7D:7H:I .KHL;OI7H;=?L;DJE7BB9ED9;HJ7JJ;D:;;I7D:7J J>;";IJ?L7BJ>;H;JKHD;:M;H;EL;HM>;BC?D=BOIKFFEHJ?L;M?J>E<H;IFEDI;I<HEC D;M9EC;HI9ECF7H;:JE?D />;)"?I79EDI?IJ;DJBOFEFKB7H;L;DJE<J;DM?J>IEB:EKJ 9ED9;HJI %D7I?DJ>;JME9>7C8;H9ED9;HJI7J.>;HC7D#7H:;DIIEB:EKJ7>;7:E<9ED9;HJ :7O +KH7K:?;D9;I7H;C7?DBOH;I?:;DJI<HECJ>;?CC;:?7J;*;MFEHJ;79>7H;77D:D;7H8O 9ECCKD?J?;I /?9A;JI7B;I?DM;H;9ECF7H78B;JEHEK=>BO>?=>;HJ>7D?DM?J>7 I?=D?<?97DJ7JJ;D:?D=<EHJ>;<?HIJJ?C;9ECF7H;:JE?D />?I8EEIJ?D<?HIJJ?C;HI KD:;HI9EH;IJ>;?CFEHJ7D9;E<EKHEKJH;79>;<<EHJI;79>O;7H7I;L;DBED=J?C;*;MFEHJ;79>H;I?:;DJI 9EDJ?DK;JE:?I9EL;HJ>;)" .KIJ7?D?D=7D::;L;BEF?D=EKHC7HA;J?D=7D:EKJH;79>MEHA9EDJ?DK;IJE 8;7FH?EH?JO JJ>;"7BB,H;L?;M<EHJ>;1?L7B:?";IJJ>;)"UI8H7IIGK?DJ;JFB7O;:?DJ>; .9KBFJKH;#7H:;D7D:EDJ>;9ECCKD?JOHEECF7J?E7D:7I?DM;>7:D;M9EC;HI7JJ;D: +KH #7B7?I?D;7HBO)7H9>H7J>;HJ>7DEKHJOF?97BB7J;&7DK7HO";8HK7HO7IM;9EDJ?DK;JEIJH7J;=?P;8;JJ;H 7D:CEH;M7OIJE8K?B:7JJ;D:7D9; 61 ;I9H?8;J>;IF;9?<?9FHE@;9JFHE=H7CJ>7JM?BB8;<KD:;:8O79KBJKH7B=H7DJ %D9BK:;>EMJ>;FHEFEI;: FHE@;9JFHE=H7CM?BB8;?CFB;C;DJ;:7D:EKJB?D;7I9>;:KB;EHFHE@;9JJ?C;B?D;M?J>FB7DD;::7J;I7D: BE97J?EDI %:;DJ?<O?D:?L?:K7BI7D:=HEKFI?DLEBL;:F7HJ?9KB7HBO7HJ?IJI7D:F;H<EHC;HI7D::;I9H?8;J>;?H HEB;I7D:H;IFEDI?8?B?J?;I ;I9H?8;J>;879A=HEKD:7D:GK7B?<?97J?EDIE<OEKHEH=7D?P7J?ED7D:A;O F;HIEDD;BJE8;?DLEBL;:?DJ>;FHE=H7C !#($"( !#" !!"# !#' """ !#" !!"$"# !#$#(%%#&!"" #!#"& !# %IJ>?I7D;M--+%---EH;N?IJ?D=---FHE@;9JFHE=H7C />;"?D7B;M?BB<E9KIED;LE97J?L;LE97BMEHAI8O1?L7B:?7D:>?I1;D;J?7D9EDJ;CFEH7HODJED?E(EJJ? .EBEIEFH7DE7D:C;PPEIEFH7DEEKJE<JEMD;HI@E?DJ>;";IJ?L7B+H9>;IJH77BE97BH?I?D= IJ7HI;9ED:IEFH7DE7D:<?L;7::?J?ED7BBE97BI?D=;HIB;:8OBKC;DIJE9A<HECJ>;L?EB?D EJ>C7?D IEBE?IJIC7A;J>;?H";IJ?L7B:;8KJIJ>;);N?97DC;PPEIEFH7DE;9?B?7 K7HJ;FH7?I;:8OJ>;*;M4EHA /?C;I7IS9H;7COLE?9;:C;PPEIEFH7DETM7I8EHD?D>?>K7>K7);N?9E7D:?I87I;:?D$EKIJED ;9?B?7>7I7D?DJ;HD7J?ED7B97H;;H?D;7HBO7D:9EDJ;CFEH7HOCKI?97D:?ICK9>IEK=>J7<J;H<EH7HEGK; H;F;HJE?H; )7O7'>;H7D?M>E?I9KHH;DJBOJ8:?I7D%D:?7DC;H?97DI?D=;HM?J>7SH?9>IE7H?D= IEFH7DET7D:S9HOIJ7BB?D;JED;T+F;H7*;MIM>EI;LE?9;>7I8;;D9ECF7H;:JESJ>;IF7HAB?D= ;<<;HL;I9;D9;E<7<?D;9>7CF7=D;TEIJED)KI?9%DJ;BB?=;D9;H.>;?I9KHH;DJBO87I;:?D*EHJ>;HD 7B?<EHD?7 />;I?N+7D:(87I;:I?D=;HI@E?DJ>;IEBE?IJIJE<EHC7JMEJE7F7HJ9>EHKIED;JE7 F7HJ<EHJ>;(EJJ? .;9ED:IEFH7DE::O.J;HH;JJM?BBIJ;FEKJ<EH7:K;JCEL;C;DJ?DJ>; ! %D7::?J?ED7HEGK;JHKCF;JIEBE?IJ'7J>HOD::K9?M?BB@E?DKI7=7?D<HEC*7I>L?BB;/*JEFB7OJ>; :;C7D:?D=BO>?=>IEBEJHKCF;JF7HJ?D1?L7B:?UI ! />;FHEFEI;:*=H7DJMEKB:IKFFEHJ<;;I 7D:JH7L;B<EHJ>;JMEC7?DLE97BIEBE?IJI7D:J>;IF;9?7B?IJ7HEGK;JHKCF;J;H7D:9EDJH?8KJ;JE<;;I7D: BE97BJH7L;B<EHJ>;I?N(87I;:I?D=;HI "KD:IM?BB7BIEIK8I?:?P;IJK:;DJHKI>J?9A;JI<EH7BB9ED9;HJI I ?DFH?EHH;9;DJO;7HIHKI>J?9A;JIM?BB8;7L7?B78B;JE*)0. IJK:;DJIU<7C?BOC;C8;HI7IM;BB7IJ>; IJK:;DJIJ>;O7H;799ECF7DO?D= #H7DJCED?;IM?BB>;BF<KD:?DL?J7J?EDI<EHC?::B;I9>EEB>?=>I9>EEB 7D:9EBB;=;IJK:;DJI<HEC*;MFEHJ;79>7D:D;7H8OJE7JJ;D:J>;"?D7B;:H;IIH;>;7HI7BED&KD;FBKI J>;EF;D?D=9ED9;HJ:H;IIH;>;7HI7BED&KD; />;I;8;>?D:J>;I9;D;IEFFEHJKD?J?;IH;L;7BJ>;:;J7?B;: H;>;7HI7BFHE9;II<HECKF9BEI;JEJ>;CKI?9?7DI .JK:;DJI97D7IAGK;IJ?EDI;NFBEH;J>;?DIJHKC;DJI7D: KD:;HIJ7D:>EMJ>;9ECFEI;HIJ>;CI;BL;I>;7H:J>?ICKI?98;<EH;7JJ;D:?D=J>;<EHC7B9ED9;HJJ>;D;NJ :7O %D9EDJ;NJJ>;9ECFB;J;I9>;:KB;?D9BK:;I&KD; $!""BKC;DIJE9AUI<?HIJ<KBB F;H<EHC7D9;<EHO;7HI=?L;D?DJ>;J>O;7HE<J>;I;JUIFK8B?97J?ED7J.J )7HA,H;I8OJ;H?7D *;MFEHJ;79>";IJ?L7B+H9>;IJH7EJ>;HIMEHAI?D9BK:;1?L7B:?UI(KJ;ED9;HJEM?J>.J;F>;D.JK88I IEBE?IJ&KD;% #7J.J )?9>7;BBBD=;BIEHED7:;B)7H:;J7?BIJE8;7DDEKD9;: &KD;%"7J.>;HC7D(?8H7HO#7H:;DI7HEGK;M?D:9>7C8;HCKI?98O1?L7B:? E?ICEHJ?;H7D:/;B;C7DD&KD;$!##"# !"7J.>;HC7D#7H:;DI;7HBO9B7II?97BIJH?D= GK7HJ;JI?DJ>;?HIE9?E>?IJEH?99EDJ;NJ7D:&KD;7J.J )7HA,H;I8OJ;H?7D "#% ! 9ECFH?I?D=1?L7B:?UI !(EJJ?UI!$'$"JMEIEBE1?L7B:?97DJ7J7I7D:1?L7B:?EH9>;IJH7BMEHAI ;<?D;EH:;I9H?8;J>;I;=C;DJE<J>;FEFKB7J?ED?D*;MFEHJ;79>J>7JOEK?DJ;D:JEI;HL;8OOEKH FHE@;9JFHE=H7C %D9BK:;IK9>J>?D=I7I7=;BE97J?EDDKC8;HII;HL;:;J9 2>?B;";IJ?L7B7JJ;D:;;I=;D;H7BBOIA;MJEBE97B7D:D;7H8O7H;7H;I?:;DJI?DJ>; 7=;H7D=; J>;H;?I=EE:H;FH;I;DJ7J?EDE<EJ>;H=HEKFI?D9BK:?D=<7C?B?;I7D:BE97BIJK:;DJI FFHEN?C7J;BOE< EKHC7?B?D=B?IJE<DEMD;7HBOH;I?:;I?DJ>;EHP?F9E:;I />;I;BE97B IKFFEHJ;HIH;FH;I;DJ;:E<";IJ?L7B7JJ;D:;;I?D7IC7BB?D9H;7I;<HEC?D 62 ECFB;J;J>;FHE@;9J8K:=;J<EHC ::H;II(#$#!#" !#DEJOEKH7DDK7B EF;H7J?D=8K:=;J "EHCKBJ?FHE@;9JFHEFEI7BIFB;7I;:KFB?97J;7D:<?BBEKJ78K:=;J<EH;79>FHE@;9J ,B;7I;7DDEJ7J;J>;8K:=;J7JJ>;8EJJEC?<J>;H;7H;:;J7?BIIK9>7I78H;7A:EMDE<F;HIEDD;BEH7 C7HA;J?D=8K:=;J9H?J?97BJEJ>;FHEFEI7B #$"&'& A:16:43>;9@52 6@E;3!2C<;>@2.05 A:16:43>;9 "@52>%;A>02? *#!%%#2>?;::28 HJ?IJ?9 :C?D?IJH7J?L; /;9>D?97B,HE:K9J?ED *#!%%"<2>.@6:4 "79?B?JO!NF;DI;.F79;-;DJ7B )7HA;J?D= ,HE:K9J?ED!N>?8?J?ED !NF;DI; /EKH?D=,H;I;DJ7J?ED!NF;DI; !:K97J?ED7B)7J;H?7BI /H7DIFEHJ7J?ED !GK?FC;DJ +J>;H?<=H;7J;HJ>7D7DDEJ7J; 8;BEM $!&"& ;I9H?8;J>;;NF;9J;:=A.:@636./82EKJ9EC;IE<OEKHFHE@;9JFHE=H7C7D:>EMOEKM?BB;L7BK7J;J>; H;IKBJI ;L;HOIF;9?<?9?D7::H;II?D=J>;M7OIJ>7JOEKM?BB:;J;HC?D;J>7JOEKHFHE@;9JFHE=H7CC;J J>;D;;:IJ>7JOEK?:;DJ?<?;:7D:799ECFB?I>;IJ>;=E7BIOEKI;JEKJJE79>?;L;? ; OEKFHEL?:; >EKHIE<CKI?97B?DIJHK9J?ED7D:?DIJHKC;DJIJEJ>;9>?B:H;D7J*;MFEHJ!B;C;DJ7HOI9>EEB7I C;7IKH;:8OCKI?9IJEH;H;DJ7BH;9;?FJI7D:BE=IE<?DIJHK9JEHI />;";IJ?L7BM?BB>EIJ<?L;9ED9;HJI&KD;7J.>;HC7D(?8H7HO#7H:;DI7D:?DBE97B9>KH9>;I ;<EH;;79>9ED9;HJEKHEKJ:EEH8H7IIGK?DJ;JM?BBFB7OJEM;B9EC;=K;IJI7D:;D>7D9;J>;9ED9;HJ=E?D= ;NF;H?;D9;7BED=M?J>FH;9ED9;HJM?D;M7J;HI7J.>;HC7D#7H:;DI %DJEJ7B";IJ?L7BCKI?9?7DIM?BB F;H<EHCEL;H>EKHIE<CKI?9 2;M?BBL;H?<OJ>?I8O7K:?J?D=9ED9;HJIJ7HJ7D:;D:J?C;I<79JEH?D=?D ?DJ;HC?II?EDI +L;HJ>;;?=>J:7OIJ>;";IJ?L7BM?BB;CFBEOCKI?9?7DI?D9BK:?D=7HEGK;IF;9?7B?IJ LE97B?IJIEH9>;IJH7BFB7O;HI7D:EJ>;HFHE<;II?ED7BI ,7OHEBBH;9EH:IM?BB:E9KC;DJCKI?9?7D;CFBEOC;DJ DKC8;HI />;FHE=H7CM?BB9EDI?IJFH?C7H?BOE<7HEGK;;H7CKI?99>EI;D8O!B?P78;J>BKC;DIJE9A KBJKH7BHJI#H7DJM?BBI?=D?<?97DJBO>;BFM?J>>?=>"?D7B;IEBE?IJ7D:IF;9?7B?IJCKI?9?7D;NF;DI;I7D: J>;HEBBEKJE<";IJ?L7BIJK:;DJEFFEHJKD?J?;I /?9A;JI7B;IEDBO9EL;H;:E<:?H;9J";IJ?L7B9EIJI 7=7?D?D:K;JEIK8IJ7DJ?7BBOH?I?D=9EIJI;IF;9?7BBO?D7?H<7H;I97J;H?D=<EHF7JHEDI7D:CKI?9?7DI 7D:FH?DJ?D= +KHE8@;9J?L;?IJEFHEL?:;J>;BE97B9ECCKD?JO7D:F;EFB;<HECJ>;IKHHEKD:?D=7H;7M?J>7 I;H?;IE<>?=>GK7B?JO7HEGK;F;H<EHC7D9;IM?J>7D;:K97J?ED7B9ECFED;DJ 2;M?BB7II;II7K:?;D9; 7FFHEL7BH7J?D=IKI?D=IKHL;O<EHCIM>?9>";IJ?L7BB;7:;HI>?FM?BB7IAJ>;7K:?;D9;JE9ECFB;J;7J;79> 9ED9;HJ %D7::?J?EDJE;L7BK7J?D==K;IJIUI7J?I<79J?EDJ>;IKHL;OI>;BF";IJ?L7BC7D7=;C;DJ:;J;HC?D; M7OIJE?CFHEL;J>;EL;H7BB";IJ?L7B;NF;H?;D9;<EHJ>;<EBBEM?D=O;7H 63 JJ79>C;DJI-;GK;IJ;: •B?IJE<E7H:);C8;HI7D:J>;?H7<<?B?7J?EDI •H;9;DJB?IJE<?D:?L?:K7BI9EHFEH7J?EDI7D:<EKD:7J?EDIJ>7JFHEL?:;EH=7D?P7J?ED7BIKFFEHJDEJ JE;N9;;:ED;F7=; •%<OEK7H;79EH=7D?P7J?ED7JJ79>79EFOE<OEKH%-.:;J;HC?D7J?EDB;JJ;HEHOEKH<?I97B 7=;DJUI?D:?97J?D=J7N;N;CFJIJ7JKI •":28HE9>KH;7D:EH;:2FH;II9B?FF?D= EDEJI;D:F>EJEIL?:;EI IEH7DOEJ>;H ;NJH7D;EKIC7J;H?7B %JM?BBDEJ8;FH;I;DJ;:JEJ>;?JOHJIECC?II?ED ,B;7I;9ECFB;J;J>?IEF;H7J?D=8K:=;J<EHC<EH7D: />?I?IDEJJ>; FHE@;9JFHE=H7C8K:=;J<EHM>?9>OEK7H;7FFBO?D=8KJOEKHEL;H7BBEH=7D?P7J?ED7B8K:=;J 4EKC7O7DDEJ7J;7JJ>;8EJJEC?<J>;H;7H;:;J7?BI9H?J?97BJEJ>;FHEFEI7B "#$&!'& 0@A.8? A142@ :0;920.?5;:8E EDJH?8KJ;: !7HD;: &;@.8:0;92 D<2:?2? ,HE=H7C #;D;H7B7D::C?D?IJH7J?L; )7HA;J?D=7D: ;L;BEFC;DJ &;@.8D<2:?2? "<2>.@6:4%A><8A?23606@ %D9EC;C?DKI!NF;DI;I (A:1.8.:02.@246::6:4;3 +2.> (00A9A8.@21%A><8A?23606@ ::B?D;I%%%7D:%1 (:6:1;:@>6/A@6;:?7JJ79> I9>;:KB;?<=H;7J;HJ>7DE<JEJ7B ?D9EC; %L;H?<OJ>7JJ>;?D<EHC7J?EDIK8C?JJ;:?DJ>?I7FFB?97J?ED?IJHK;7D:9EHH;9JJEJ>;8;IJE<CO ADEMB;:=; *7C;6666665;D!:M7H:I66666666/?JB;666!N;9KJ?L; ?H;9JEH666666666 .?=D7JKH;66666 6666 7J;66&7DK7HO666666666 64 BAROQUE MUSIC FESTIVAL, CORONA DEL MAR Executive Committee Wayne Norman, President Steven Dember, Treasurer Vina Spiehler, Secretary Board of Directors 2024 Philip Benguhe Home: (949) 276-3668 4 Blue River Cell: (949) 378-5167 Irvine, CA 92604 Email: pbenguhe@gmail.com Philip Benguhe Project Manager, Sunworks USA Dorothy Boesch Home: (714) 846-3916 16807 Sea Witch Lane Cell: (714) 403-2625 Huntington Beach, CA 92649 Email: dorothyone@verizon.net Dorothy Boesch, RN Head Nurse, Long Beach Community Hospital - retired Past President, Friends of the Huntington Beach Library Patricia Bril Home: (714) 536-7764 19682 Island Bay Lane Cell: (714) 747-6922 Huntington Beach, CA 92648 Email: pbril@fullerton.edu Patricia Bril, Immediate Past President Librarian Emerita, California State University, Fullerton - retired Virginia Cassara Home: N/A 613 ½ Larkspur Cell: (949) 422-1724 Corona del Mar, CA 92625 Email: vacassara@gmail.com Virginia Cassara Realtor, Coldwell Banker– retired Steven Dember Home: (714) 879-1777 121 Avenida Santa Catalina Cell: (714) 345-4723 La Habra, CA 90631 Email: shdember@aol.com Steven Dember, Treasurer Senior Member, Technical Staff, The Boeing Company - retired Philip Friedel Home: N/A 3871 Magnolia St. Cell: (949) 551-4157 Irvine, CA 92606 Email: friedel@surfree.com Philip Friedel Aerospace Engineering Manager, Honeywell International, Inc. - retired Continues- 65 Alexandra Hart Home: N/A 8 Summer House Lane Cell: (619) 987-7794 Newport Beach CA 92660 Email: alliemarie.hart@gmail.com Alexandra Hart Sr. Director Brand & Creative, Ruggable Carol E. Kirkwood Home: (714) 840-0553 3492 Bravata Dr. Email: carol@thekirkwoods.com Huntington Beach, CA 92649 Carol Moss Kirkwood County Librarian, Los Angeles County - retired Wayne Norman Home: (562) 426-5388 3934 Brayton Ave Cell: (562) 896-5388 Long Beach, CA 90807 Email: wayneknorman@verizon.net Wayne Norman, President Principal Engineer, The Boeing Company - retired Janet Rappaport Home: N/A 3334 East Coast Highway Cell: (949) 887-8570 Suite 577 Email: witchrapp@aol.com Corona del Mar, CA 92625 Janet Rappaport, Esq. Attorney, International Business, Tax Adjunct Professor, Chapman University, Fowler School of Law Vina Spiehler, PhD Home: (949) 642-0574 422 Tustin Ave. Cell: (951) 314-3301 Newport Beach, CA 92663 Email: spiehleraa@aol.com Dr. Vina Spiehler, Secretary Forensic Toxicologist, Spiehler & Associates Elizabeth Veinsreideris Home: N/A 2404 Vista Nobleza Cell: (510) 847-1222 Newport Beach, CA 92660 Email: elizabeth.veinsreideris@gmail.com Elizabeth Veinsreideris Commercial Counsel - Legal, CrowdStrike Lynne Hayward Worley Home: (949) 644-6394 12 Rue Verte Cell: (404) 822-7907 Newport Beach, CA 92660 Email: lynnehayley@yahoo.com Lynne Hayward Worley Caribbean/Trans-Atlantic Flight Attendant, Delta Air Lines - retired Updated: October 18, 2023 66 "$ "#"!# %!" "#% "# 2024 Festival Donors, Grants, and Business Contributors 2023-2024 Major Individual Contributors $10,000 or more: B. Norris Battin, Dr. Vina R. Spiehler $5,000 to $9,999: Steven & Cynthia Dember · Thomas A. & Bonnie J. Pridonoff $3,000 to $4,999: Rochelle Bowe & Michael Ishikawa · Wayne Norman · Janet Rappaport $1,000 to $2,999: seventeen donors in this category Up to $999: fifty-seven donors in this category Foundation and Government Grants The Colburn Foundation $12,500 (operating grant) Newport Beach Arts Commission Cultural Arts Grant $4,500 Business Contributions - Employee Matching Programs Boeing $4,350 Pimco $500 67 68 69 How to Purchase Tickets •Scan the QR code to the right or visit bmf-cdm.org/tickets • Or return the order form enclosed • Or email tickets@bmf-cdm.org • Or phone (949) 760-7887 The five-concert Festival Subscription price of $325 assures premium priority-area seating at all events and includes a private post-concert dinner following the Festival Finale on Sunday, June 23, in the Fellowship Hall, St. Mark Presbyterian Church. Individual tickets are sold on a concert-by-concert basis for open seating. To gain the full Festival experience, please note: • Subscribers are mailed a seating card with their tickets to reserve a seat on arrival in the premium seating section at each venue. Outside this section, open seating is available for individual ticket-holders. • Doors open 30 minutes before concert start time at the churches (June 16, 17, 23) and 45 minutes before at Sherman Library & Gardens (June 19, 21), with access to the Gardens included in the ticket price. • $10 student rush tickets for under-30s are available at the door subject to space availability. A valid student card and photo ID are required. • Come early to our concert venues to mingle with other guests and hear our Festival regulars, the South Coast Brass quintet, play al fresco. • Complimentary wine & waters receptions are included for all ticket-holders. • Free parking is available at all venues. At Sherman Library & Gardens there is step-free access from the lower side gate on Dahlia Avenue. • What should I wear? Guests typically wear smart casual or business attire. Layers are recommended. You may also wish to bring a seat cushion to all venues. All the Pleasures! Please join artistic director Elizabeth Blumenstock, the Festival orchestra, chorus, and soloists for this year’s season, to explore the cultural significance of Italian mu- sic in Baroque-era London and much more. As we gather once again for the yearly tradition of sum- mer programs that began in 1981 under Festival founder Burton Karson, we wel- come you — or welcome you back! — for five concerts of richly varied Baroque music over eight days performed in inti- mate venues in Corona del Mar and New- port Beach. The Board of Directors is dedicated to bringing quality Baroque performances to Orange County, and we value your role in making this happen. Thank you! Concert Venues • St. Mark Presbyterian Church 2200 San Joaquin Hills Road, Newport Beach • Sherman Library & Gardens 2647 East Coast Highway, Corona del Mar • St. Michael and All Angels Episcopal Church 3233 Pacific View Drive, Corona del Mar Festival Support Tax-deductible donations and concert sponsorships are welcomed, as ticket revenue covers only 25% of Festival expenses. We appreciate gifts of any amount and acknowledge donations of $50 or more in the printed Festival program. Visit bmf-cdm.org/support-us for details. Re t u r n A d d r e s s : Na m e : St r e e t : Ci t y , S t a t e & Z i p : Is t h i s a n e w a d d r e s s ? Y e s N o Ba r o q u e M u s i c F e s t i v a l , C o r o n a d e l M a r Po s t O f f i c e B o x 8 3 8 Co r o n a d e l M a r , C A 9 2 6 2 5 - 0 8 3 8 Ple a s e Pla c e S t a m p Her e Ba r o q u e M u s i c F e s t i v a l , C o r o n a d e l M a r P.O . B o x 8 3 8 , C o r o n a d e l M a r , C A 9 2 6 2 5 - 0 8 3 8 Re s e r v e y o u r s u b s c r i p t i o n n o w a n d j o i n u s Ju n e 1 6 – 2 3 f o r “ A l l t h e P l e a s u r e s ! ” NO N P R O F I T O R G U. S . P O S T A G E PA I D SA N T A A N A , C A PE R M I T N O . 1 3 6 7 RE T U R N S E R V I C E R E Q U E S T E D Blumenstock 44th Annual Season All the Pleasures! June 16–23, 2024 Elizabeth Blumenstock Artistic Director Festival Subscription includes Premium Seating & Finale Dinner! 70 Wednesday, June 19, 2024 Sherman Library & Gardens, 7:30 p.m. Nightingales in the Gardens Elizabeth Blumenstock, Jolianne Einem and Rob Diggins (violins), with Eva Lymenstull (cello) and Ian Pritchard (harpsichord), in music for three violins by Buonamente, Pachelbel and Purcell — and more! Gates open at 6:45 p.m. for complimentary wine in the Gardens · Intermission coffee & cookies · Meet the musicians after the concert Friday, June 21, 2024 Sherman Library & Gardens, 7:30 p.m. Galante in the Gardens Late French and German Baroque chamber music, including Telemann’s “Paris” Quartet in D Major and Bach’s keyboard Toccata BWV 914. Performed by Judith Linsenberg (recorder), Lara Wickes (oboe), Elizabeth Blumenstock (violin), Michael Kaufman (cello) and Gabriel Arregui (harpsichord). Gates open at 6:45 p.m. for complimentary wine in the Gardens · Intermission coffee & cookies · Meet the musicians after the concert Sunday, June 23, 2024 St. Mark Presbyterian Church, 4 p.m. Festival Finale: Handel and Purcell Choral Odes Nola Richardson (soprano), Clifton Massey (countertenor) and Jesse Blumberg (baritone) join the Festival Orchestra and Chorus in Handel’s Ode for the Birthday of Queen Anne, “Eternal Source of Light Divine” (Kathryn Adduci, trumpet) and Purcell’s ode Welcome to All the Pleasures. Plus, instrumental selections from Purcell’s Dioclesian, and Handel’s Concerto Grosso Op. 6, No. 11. Followed by a wine & waters reception on the patio with the musicians FULL PROGRAM INFORMATION AND PERFORMER LISTS AT BMF-CDM.ORG · PROGRAM AND ARTISTS SUBJECT TO CHANGE The Festival thanks the following for their support: Please print. Festival Subscribers and supporters: this is how your name(s) will appear in the Festival program, if order is received by May 31. City, State & Zip Number & Street 2024 Subscription and Single-Ticket Order Form Please detach and mail to: Baroque Music Festival CdM, P.O. Box 838, Corona del Mar, CA 92625-0838 Name(s) Address Phone Email Price Quantity Total Festival Subscription $325 (all 5 concerts/premium seating & June 23 post-concert dinner) Single tickets: London Fog, Italian Sunshine $50 Sunday, June 16 — 4:00 p.m. Time Stands Still: English Lute Songs $45 Monday, June 17 — 7:30 p.m. Nightingales in the Gardens $55 Wednesday, June 19 — 7:30 p.m. Galante in the Gardens $55 Friday, June 21 — 7:30 p.m. Festival Finale: Handel & Purcell Odes $50 Sunday, June 23 — 4:00 p.m.Service charge $5.00 Additional tax-deductible contribution* Total Amount $ My check payable to “Baroque Music Festival, CdM” is enclosed. Charge my credit card in full: Mastercard Visa AmEx Discover Credit card number:** Card Expiration Date Security code Month Year Required Signature:Date: Sunday, June 16, 2024 St. Mark Presbyterian Church, 4 p.m. London Fog, Italian Sunshine J.C. Bach’s Sinfonia Concertante for violin and cello, concerti grossi by Corelli and Avison (after Scarlatti), Handel’s organ concerto “Cuckoo and Nightingale” (soloist Corey Jamason) and more from the Festival Orchestra led by Elizabeth Blumenstock. Followed by a wine & waters reception on the patio with the musicians Monday, June 17, 2024 St. Michael and All Angels Episcopal Church, 7:30 p.m. Time Stands Still: English Lute Songs Danielle Reutter-Harrah (soprano) and Stephen Stubbs (lute) with a guest appearance by Elizabeth Blumenstock (violin) in songs by Dowland, Lawes, Purcell and others. Followed by a wine & waters reception on the patio with the musicians Cover: Honthorst’s “The Concert” (1623), National Gallery of Art, Washington, DC. Photo credits above (left to right): Teresa Tam (Clifton Massey), Madeleine Robertson (Danielle Reutter-Harrah), American Bach Soloists (Elizabeth Blumenstock), Arielle Doneson (Jesse Blumberg), Vinnik Studio (Nola Richardson), Philharmonia Baroque (Kathryn Adduci), Miranda Loud (Stephen Stubbs). *Donor tiers: Philanthropist..$10,000+ Partner................$5,000+ Benefactor ..........$3,000+ Patron.................$1,000+ Donor ...........$500+ Contributor..$300+ Friend ...........$125+ Supporter........$50+ *Contribution Philanthropist $10 000+For further named Visit bmf-cdm.org for sponsorship info & donor benefits Media Partner All the Pleasures! The Italian Influence in London and Beyond Elizabeth Blumenstock, Artistic Director ** We use PayPal’s credit card processing service for nonprofits to keep our ticket-order service charge low. A PayPal account is not required to use credit cards for Festival tickets. 71 "55"$).&/5& 72 73 74 75 76 77 78 79 80 Emerald Magic Events Classical music concert- BALBOA BAY July 20,2024 7PM-10PM MARINA PARK CENTER -1600 W.Balboa Blvd Newport Beach ,CA GRAND PIANO &VIOLIN 1 PREVIOUS 81 Emerald Magic Events INVITATION TO EVENT DEAR FRIENDS ! Our company want to invite you to a CLASSICAL MUSIC EVENT - BALBOA BAY Date: July 20 ,2024 at 7PM Duration: 3 hours Desserts & Wine Location: MARINA PARK CENTER BALBOA PENINSULA NEWPORT BEACH ,CALIFORNIA You will meet with friends and make new acquaintances. Join our club! The LIVE EVENT will take place at an incredible venue by the ocean. You will be able to enjoy magnificent classical music (GRAND PIANO AND VIOLIN )timeless music classic CHOPIN ,MOZART ,BEETHOVEN ,PAGANINI,VIVALDI AND MORE.... performed by talented PROFESSIONAL musicians. The ticket price includes DESSERTS & WINE. There will also be a professional photographer in a red carpet style to capture your unforgettable moments. This evening promises to be filled with wonderful music, delicious ITALIAN DESSERTS , and an incredible atmosphere. Don't miss the chance to be part of this magical event! Don't miss this magical evening. Book your spot now and get ready to enjoy unforgettable classical MUSIC BY THE OCEAN...... 2 PREVIOUS 82 Emerald Magic Events 3 PREVIOUS 14301 Yale Ave, Irvine, CA 92604 Heritage Park Community Center a heading May 24,2024 3PM-6PM CLASSICAL VIOLIN -MASTER CLASS 83 Emerald Magic Events 4 OASIS SENIOR CENTER CORONA DEL MAR 7PM -10PM GRAND PIANO SAXOPHONE VIOLIN UPCOMINGOMING 4 84 Emerald Magic Events 5 GRAND PIANO ----VIOLIN ----SAXOPHONE Date MARCH 22, 2025 Duration - 3 Hours 7 PM-10 PM Location - OASIS CENTER , 801 NARCISSUS AVE ,CORONA DEL MAR ,CA Catering - DESSERTS AND DRINKS INCLUDED Age 8+ Concert Program Chopin - Walz ,Handel -Passacadlia ,Vivaldi -Storm, Brahms-Hungarian Dance,Saint Saens-The Swan,Jules Massenet-Meditation,Franz Schubert-The Bee,and more....... Broadway and Hollywood style compositions Besame Mucho ,Love Story ,Speak Softly Love ,What a Wonderful World,Shape of My Heart (Sting),Yesterday (The Beatles) Czardas (Vitorio Monti),Bella Ciao,Rock-around o’clock The lonely Shepherd Pirates of the Caribean and more......... UPCOMINGPC 85 Emerald Magic Events 6 UPCOMING Norma Hertzog Community Center 1845 Park Ave Costa Mesa, CA 92627 September 20,2025 7PM-10PM CLASSICAL GUITAR MUSIC SPANISH ROMANCE AND MORE..... SPANISH GUITAR- ELECTRONIC PIANO -DRUMS 86 Emerald Magic Events 7 UPCOMING ABOUT PROGRAMM You will find this romantic and nostalgic pieces in most collections of music for the classical guitar. Classical guitar is another evolution in his musical journey. Performing compositions from some of his favorite composers Francisco Tarrega, Agustín Barrios Mangoré, Antonio Lauro, Andrés Segovia, Heitor Villa-Lobos, and Isaac Albéniz, 7 87 Emerald Magic Events 8 Concert - MODERN CLASSICAL & CROSSOVER MUSIC . Grand piano Cello -Violin Drums -Gitar Saxophone OASIS SENIOR CENTER CORONA DEL MAR NOV.15.2025 7PM-10PM UPCOMINGPCO 8 88 9 Classical crossover is genre, a fusion of classical music with popular music styles, creates a harmonious blend that appeals to a wide range of listeners, challenging the boundaries of traditional musical classifications. This concert will showcase talented music groups from Newport Beach UPCOMINGOMING 89 $!!&! "!"! !! 6620*(:05493;9:),:?6,+58=58+685*,99,+?5;3(?8,-583(:54:/,*536;:,8(9254.(90: (66,(89:/,9(3,0,;9,!03,9,=53(4 6504:(4+:/,9(3,6(.04(:054 "9:?6+< +7/90!<1+83D+>398 /1+6 +7/30.300/</8> /./<+6%+B 9 +36381..</== 3>C )3: ''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''' 98>+-> +7/ %/6/:298/ ''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''' +B 7+36 '/,$3>/ /91<+:23-+6</+$/<@/. +@/C9?</-/3@/.+3>C90 /A:9<>/+-2?6>?<+6<>=<+8>,/09</****0=9A2/8******** (/+<9<1+83D+>398A+=09?8./. ?7,/<90:+3.=>+00'''''90+->3@/@96?8>//<=''' ''' !5:(2(35;4:8,7;,9:,+0<97</;?/=>638/90:<94/->,?.1/>''''''''' 9:03(:,+4;3),85-6,562,04,=658:,(*/:/(::/,685659,+6851,*:9=0229,8<,''''''' $77$&+0(17) 90 Musica Transalpina 87-4318307 Musica Transalpina, c/o Bryan Roach, 2520 Kincaid Drive, Apt 101 Costa Mesa, CA Kay Wolfe 424-536-6744 kcwolfe@protonmail.com https://musicatransalpina.org/ Southern California No 2021 1*15 5000 150+ 92626 *Bryan Roach, the founder and director, is our only salaried staff, and we rely on an excellent network of volunteers who are passionate about their mission. We do, however, employ our musicians and singers regularly and consider them part of the Ensemble, especially our core musicians listed for this program. Kay Wolfe 424-536-6744Kay Wolfe 424 536 6744 "!"! !! <3/06C./=-<3,/,/69AC9?<9<1+83D+>398G=:?<:9=/73==398+8.19+6= ./8>30C+8../=-<3,/A2C>2/</3=+8//.04:/,,=658:,(*/533;40:?09<C9?<:<9:9=/. :<94/-> :<91<+78-6?./+;?+8>3>+>3@/./=-<3:>39890>2/8//.+8.98A2+>C9?,+=/.C9?<038.381= 3/E+=/.98+=>?.C.98/,C>2/"%>2/</+</98/2?8.</.-236.</838>2/>2>21<+./=+> /A:9<>6/7/8>+<CA292+@/2+.89><+38381A3>27?=3-+638=><?7/8>=F/=-<3,/29AC9?2+@/ ./>/<738/.>2+>C9?<9<1+83D+>3983=>2/9<1+83D+>39809<>2/:<9:9=/.:<94/-> :<91<+7 91 Musica Transalpina is a professional vocal & period instrument Ensemble dedicated to the research & performance of Baroque sacred music, including extremely rare and ambitious pieces. We are committed to the highest standards of musical research and artistic excellence. The Ensemble is quickly becoming one of the leading interpreters of Baroque music in the nation. Led by Orange County native, Bryan Roach, Musica Transalpina seeks to address a lack of performances of this obscure and forgotten but exquisitely beautiful musical era. Of particular interest is the exposure of the youth to this period of music, as well as serving areas of Southern California where this music is less easily available. Various demographics, especially families with children or the elderly population, find distance to sacred music events is an obstruction and it is a joy for the Ensemble to offer events in closer geographical proximity to fill this gap. Based on the exploration of sacred music events and various ensembles available in Southern California, particularly of world-class caliber, Orange County is markedly less saturated than Los Angeles, including Newport Beach where we have many Baroque music enthusiasts. Despite this love for the music, few are willing to travel the hours required to attend deep in Los Angeles County, or are simply unable to; we get this feedback regularly. Los Angeles is internationally well-known as offering the highest quality of all kinds of sacred music, but few recognize the challenges of distance for the more local but still distant Southern Californian population. In particular, we see a great resonance with school-aged children and youth, as well as the senior population; these demographics, however, are also the least likely to be able to bridge the gap to events far away. It does not need to be this way. Our desire is to see Orange County, with Newport Beach as one of the the main hubs, become a destination for top tier classical music. Our organization is best equipped to perform some of the most difficult and rare pieces of the Baroque period at the highest level of artistic excellence, as well as well-networked to successfully affect the musical climate of the city and area, including the lives of students at schools. Our talent roster is uncompromisingly excellent, as will be shared in a following question, and our director is both extremely passionate about Baroque music and capable of bringing it fully to life at the highest quality. Though a young organization, our Ensemble has already successfully completed many performances, to the delight and enthusiasm of a growing base of listeners. We can be trusted to execute a proposed program at the utmost professional standards. /=-<3,/>2/=:/-303-:<94/-> :<91<+7>2+>A366,/0?8./.,C+?6>?<+6<>=<+8>8-6?./29A>2/ :<9:9=/.:<94/-> :<91<+7A366,/37:6/7/8>/.+8.9?>638/+=-2/.?6/9<:<94/->>37/638/A3>2:6+88/. .+>/=+8.69-+>398=./8>30C38.3@3.?+6=+8.1<9?:=38@96@/.:+<>3-?6+<6C+<>3=>=+8.:/<09<7/<=+8. ./=-<3,/ >2/3< <96/= +8. </=:98=3,363>3/= /=-<3,/ >2/ ,+-51<9?8. +8. ;?+6303-+>398= 90 C9?< 9<1+83D+>398+8.5/C:/<=988/6>9,/38@96@/.38>2/:<91<+7 =>23=+8/A'''''9</B3=>381'''':<94/-> :<91<+7 /038/9<./=-<3,/>2/=/17/8>90>2/:9:?6+>39838 /A:9<>/+-2>2+>C9?38>/8.>9=/<@/,CC9?< :<94/-> :<91<+78-6?./=?-2>2381=+=+1/69-+>3988?7,/<==/<@/./>- 92 Our specific program for which this grant will be applicable will be a performance of very rare Baroque music at St. Mark’s Presbyterian Church in Newport Beach.* The program, comprised of Marian hymns by female composers of the 17th Century, will be added as an annotation in conjunction with this application. Our roster of musicians and singers are top tier professionals in Southern California and include: multi-award-winning soloist, Anna Schubert; guitar instrumentalist and founder of the Boston Baroque music festival, Stephen Stubbs, and Maxine Islander, professor at USC and known as the world’s best Baroque harpist. Our Ensemble has consistently executed on highly-ambitious, rare Baroque music in a variety of contexts in the last few years, helping to kindle serious and growing interest in classical music generally and historical Baroque music specifically, including among many high school students in attendance at our performances. Our founder and director, Bryan Roach, is of unique caliber and excellence, and able to attract Southern California’s greatest classical music talent. Upon reception of the grant, he will immediately book our singers and musicians, with three daily rehearsals (May 15th, 16th, and 17th) immediately preceding the performance on Sunday, May 18th, 2025, at 4:00pm. As said in earlier sections, the Ensemble is passionate about increasing interest in Baroque music in currently unfamiliar demographics, as well as serving existing demographics in being able to attend performances and events more easily. We are especially focused on getting students out to experience this music in a beautiful context, as an encounter with the arts in this way is frequently the most powerful; we have had regular feedback that high school age attendees are developing a passion for this music simply through attendance at our concerts. To this end, we have planned outreach to the various local schools, targeting ages 7 up to 18, with an emphasis on 6th Grade and up band and choral students. Our goal is to draw 50 students to the performance by offering them complimentary tickets through the schools’ arts and music programs. While the students are our concrete focus for this event, we are also aware of and grateful for our senior aged attendees and enthusiasts, and are grateful to offer a more distance-accessible options for this music specifically for them. *We are in conversation with St. Mark’s and anticipating this venue working, but have several other alternate venue options in the unlikely event of any difficulty. 97:6/>/>2/:<94/->,?.1/>09<7..</== 89>C9?<+88?+6 9:/<+>381,?.1/>9<7?6>3:<94/->:<9:9=+6=:6/+=/.?:63-+>/+8.03669?>+,?.1/>09</+-2:<94/-> "6/+=/+889>+>/>2/,?.1/>+>>2/,9>>9730>2/</+</./>+36==?-2+=+,</+5.9A890:/<=988/69<+ 7+<5/>381,?.1/>-<3>3-+6>9>2/:<9:9=+6 !"!;4+04.-853:/, 0:?5-,=658:,(*/ ;4+04.-853 :/,8 5;8*,9 % ,89544,2 <>3=>3- .7383=><+>3@/ %/-283-+6"<9.?->398 % 6,8(:04. +-363>CB:/8=/ $:+-/#/8>+6 +<5/>381 "<9.?->398 B23,3>398 B:/8=/ %9?<381 "</=/8>+>398B:/8=/ .?-+>398+6+>/<3+6= %<+8=:9<>+>398 ;?3:7/8> !>2/<301</+>/<>2+8 +889>+>/,/69A !! /=-<3,/>2//B:/->/.7;(4:0-0()2,9?>-97/=90C9?<:<94/-> :<91<+7+8.29AC9?A366/@+6?+>/>2/ </=?6>=/@/<C=:/-303-38+..</==381>2/A+C=>2+>C9?A366./>/<738/>2+>C9?<:<94/-> :<91<+77/> >2/8//.=>2+>C9?3./8>303/.+8.+--97:63=2/=>2/19+6=C9?=/>9?>>9+-23/@/3/C9?:<9@3./ 29?<=907?=3-+638=><?->398+8.38=><?7/8>=>9>2/ -236.</8+> /A:9<>6/7/8>+<C=-2996+= 7/+=?</.,C7?=3-=>9</</8>+6</-/3:>=+8.691=9038=><?->9<= 93 n/a $3000 We will consider our program a success when we draw 150+ attendees total, with 50 of those from Newport Beach and surrounding area schools in the age category 7-18/2nd Grade-12th Grade. Our goal is to succeed at this first goal, take in the information from our first experience offering this in a formal way, and apply that experience to future concerts, with a view to making attendance with this demographic more regular, fruitful, and numerous. Quantitatively, we will also ask for teachers of student attendees to offer feedback about the event and student experience with the same future, long-term goals in mind. $4,000 (optional; recording if budget) $950 $1000 $700$50 $1000 n/a (incl. in artist fees) n/a $2000 $9,480 $18,180 (or $22,180 if recording budget becomes available) n/a $0 $0 Notes: we are attaching the list of performers and their respective pay for rehearsals and performance, along with the director fee. Marketing will be for Meta ads, and is not our only means of promotion. The equipment needed is a period-based organ. Our other funding sources are a combination of donations and ticket sales, and we are confident that those sources, combined with this grant, will make this a great success. Musica Transalpina: Program for May 18th, 2025 Program in Newport Beach All of the following are Marian hymns brought to us by female composers of the 17th century: Isabella Leonarda: 12. Sonata Duodecima a Violino Solo from “Sonate a 1. 2. 3. e 4 Istromenti”, Op. 16. (Bologna, 1683) Chiara Maria Cozzolani: 2. O quam tristia es from “Scherzi di sacra Melodia”. (Venice, 1648) Leonarda: 2. Quam dulcis. Canto solo, 2 Violini, from “Mottetti a 1, 2 e 3 voci con violini, e senza”, Op. 13. (Bologna, 1687) Leonarda: 5. Sonata Quinta from “Sonate” (Op. 16). Bologna, 1683. Domenico Scarlatti: Keyboard Sonata in b minor. No. 27 from “Essercizi per Gravicembalo” (1738) Leonarda: 5. Ave suavis dilectio from “Motetti a voce sola”, Op. 6. (Venice, 1676). 94 95 >>+-27/8>=#/;?/=>/. x 63=>909+<./7,/<=+8.>2/3<+00363+>398= x </-/8>63=>9038.3@3.?+6=-9<:9<+>398=+8.09?8.+>398=>2+>:<9@3./9<1+83D+>398+6=?::9<>89> >9/B-//.98/:+1/ x 0C9?+</+ - 9<1+83D+>398+>>+-2+-9:C90C9?<#$./>/<738+>3986/>>/<9<C9?<03=-+6 +1/8>G=38.3-+>381>+B/B/7:>=>+>?= x 4,,<9-2?</+8. 9<54,:</==-63::381989>=/8.:29>9=@3./9==9<+8C9>2/</B><+8/9?= 7+>/<3+6>A36689>,/:</=/8>/.>9>2/3>C<>=9773==398 "6/+=/-97:6/>/>23=9:/<+>381,?.1/>09<709< +8. %23=3=89>>2/ :<94/-> :<91<+7,?.1/>09<A23-2C9?+</+::6C381,?>C9?<9@/<+669<1+83D+>398+6,?.1/> (9?7+C+889>+>/+>>2/,9>>9730>2/</+</./>+36=-<3>3-+6>9>2/:<9:9=+6 !"! ;+.,:*;88,4: ;+.,:6851,*:,+ 4*53,*(9/542? 98><3,?>/. +<8/. !5:(24*53, >6,49,9 "<91<+7 /8/<+6+8..7383=><+>3@/ +<5/>381+8./@/69:7/8> !5:(2>6,49,9 6,8(:04. ;862;9,-0*0: 8-97/738?=B:/8=/= # ;4+(2(4*,(: ,.04404.5-&,(8 # **;3;2(:,+ ;862;9 ,-0*0: ..638/=+8.& # 404+54:80);:0549 +>>+-2=-2/.?6/301</+>/<>2+8 90>9>+638-97/ @/<30C>2+>>2/3809<7+>398=?,73>>/.38>23=+::63-+>3983=><?/+8.-9<</->>9>2/,/=>907C 589A6/.1/ +7/************************************%3>6/************************************ $318+>?</******************************************+>/*************************** 3OHDVHVHHDWWDFKPHQWVRQQH[WSDJHIRURSHUDWLQJEXGJHW 96 Kathleen Wolfe Grants Manager January 10, 2025 97 Musica Transalpina: Additional Information for ewport Beach City Cultural Arts Grant Current Board Members: 1.Bryan Roach, Chairman. Founder & Director of Musica Transalpina baroque ensemble. \ 2.oah Gladstone, Secretary. Co-founder of both Tesserae Baroque and Musica Transalpina. 3.Dr. Alexandria Coronado Hughes, Treasurer. Former Commissioner of the Orange County Historical Commission. 4.Rev. Hugh C. Barbour, O. Præm, Chaplain. Former Prior of St. Michael’s Abbey of Silverado, California. Organizational Support: 1. The Colburn Foundation, generous grants 2. St. Peter & Paul Church, Wilmington, CA, regular venue, fundraising, and community support 3. St. Andrew’s Parish, Pasadena, regular venue 4. Our Lady, Queen of the Angels, Newport Beach, CA, regular venue 5. The De Camera Society, collaborator 6. Clement Decker, donor 98 99 100 1 NEWPORT BEACH CITY ARTS COMMISSION 2024-25 CULTURAL ARTS GRANT APPLICATION (Applications must be typed or word-processed- you may reformat on the computer as long as it appears the same: i.e. use Times New Roman 12 point and the same pagination.) Popular Name of Organization Legal Name (if different) Federal Tax ID No. Mailing Address City Zip _____________________________________________________________________________________ Contact Name Telephone _______________________________________________________LQIR#QWDFWLFNHWVFRP______________________________ Fax E-mail Web Site Geographical Area Served Have you received a City of Newport Beach Cultural Arts Grant before? __QR__ If so, when? ________ Year organization was founded Number of paid staff B____ # of active volunteers ___ ___ Total amount requested: (from request line of project budget) $B___ Estimated number of people in Newport Beach that the proposed project(s) will serve: _____ 1HZSRUW7KHDWUH$UWV&HQWHU 2501 Cliff Drive Newport Beach 92663 95-3251950 (949)631-0288 www.ntactickets.com Bob Fetes Friends of Newport Theatre Arts Center $77$&+0(17* 101 2 CULTURAL ARTS GRANT APPLICATION 1. Briefly describe below your organization’s purpose, mission, and goals. 2. Identify and describe why there is a need in the Newport Beach Community for your proposed project/program. Include a quantitative description of the need and on what you based your findings (i.e. “Based on a study done by the PTA, there are one hundred children in the 4th-6th grades at Newport Elementary who have had no training with musical instruments.” ) Describe how you have determined that your organization is the best organization for the proposed project/program. 1HZSRUW7KHDWUH$UWV&HQWHUHQWHUWDLQVHQJDJHVDQGHGXFDWHVSHRSOHIURPDOOZDONVRIOLIHWKURXJK WKHDWULFDOSHUIRUPDQFHVDQGLQYROYHPHQWZLWKRXUFRPPXQLW\ :HEHOLHYHLQDGYRFDWLQJIRUWKHLQFOXVLRQRIWKHSHUIRUPDQFHDUWVLQDZHOOURXQGHGOLIH SURPRWLQJDQHQYLURQPHQWWKDWLVRSHQQXUWXULQJLQYLWLQJDQGLQFOXVLYHRISDUWLFLSDWLRQIURPWKH ZKROHFRPPXQLW\ :HDUHGHGLFDWHGWRFUHDWLQJFKDOOHQJLQJHQJDJLQJDQGUHZDUGLQJRSSRUWXQLWLHVIRUDUWLVWV WHFKQLFLDQVDQGDVSLULQJSURIHVVLRQDOV2XUPLVVLRQLQFOXGHVIRVWHULQJWKHSHUVRQDODUWLVWLFJURZWK RIDOOSDUWLFLSDQWVDQGZHDUHFRPPLWWHGWRWKHFRQWLQXHGH[LVWHQFHRIOLYHWKHDWHULQRXU FRPPXQLW\ :HDUHDZDUHWKHWKHUHLVDQHHGZLWKLQWKH1HZSRUW%HDFKFRPPXQLW\WRH[SDQGWKHUHDFKRIRXU WKHDWHU:HFXUUHQWO\FRQGXFWSHUIRUPDQFHVD\HDULQFOXGLQJDYDULHW\RITXDOLW\PXVLFDOVGUDPDV FRPHGLHVPXUGHUP\VWHULHVDQGDKROLGD\VKRZ$WDOPRVWHYHU\SHUIRUPDQFHZHPHHWDSDWURQ ZKRKDVQHYHUDWWHQGHGRXUWKHDWUHHYHQWKRXJKZHKDYHEHHQWKHRQO\OLYHWKHDWUHLQ1HZSRUW %HDFKIRURYHU\HDUV$QGLQPDQ\FDVHVWKHVHSDWURQVWHOOXVWKDWWKLVLVWKHLUILUVWWLPHVHHLQJ DQ\W\SHRIOLYHWKHDWUH :HIHHOWKDWE\H[SDQGLQJRXUFRPPXQLW\UHDFKDQGH[SRVLQJQHZUHVLGHQFHWRRXUWKHDWHUWKDWZH FDQLQFUHDVHWKHFRPPXQLW\SDUWLFLSDWLRQDQGVXSSRUWRIRXURUJDQL]DWLRQ/DVWO\RXUJRDOLVWR HVWDEOLVKDPRUHSRVLWLYHLPDJHDQGLQFUHDVHLQYROYHPHQWZLWKWKHVXUURXQGLQJQHLJKERUKRRGV 102 3 3. Describe the specific project/program that will be funded by a Cultural Arts Grant. Include how the proposed project/program will be implemented and outline a schedule or project timeline, with planned dates and locations. Identify individuals and groups involved, particularly artists and performers, and describe their roles and responsibilities. Describe the background and qualifications of your organization and key personnel to be involved in the program. Remember: the City funds projects and programs only - not operating expenses. These projects and programs must promote community involvement and awareness of the arts in Newport Beach. Is this a new__[___ or existing ___ _ project/program? 4. Define or describe the segment of the population in Newport Beach that you intend to serve by your 1HZSRUW7KHDWUH$UWV&HQWHUZRXOGOLNHWRFRQGXFWDWKHDWUHVHPLQDUIRUWKHORFDOFRPPXQLW\:HSODQ RQFRQGXFWLQJPXOWLSOHVHVVLRQVWKURXJKRXWWKHGD\IRUFKLOGUHQDQGDGXOWV 2XUFRQFHSWLRQLVWRRIIHUWKHIROORZLQJVHVVLRQVDFWLQJIRUQRYLFHVLQWHUPHGLDWHDQGDGYDQFHGDFWRUV GDQFHVLQJLQJWKHDWHUJDPHVLPSURYLVDWLRQDXGLWLRQLQJFRVWXPLQJVHWGHVLJQOLJKWDQGVRXQGGHVLJQ DQGEDVLFGLUHFWLQJWHFKQLTXHV 1HZSRUW7KHDWUH$UWV&HQWHUKDVEHHQDVWDSOHRIRXUFRPPXQLW\IRURYHU\HDUVDQGGXULQJWKDWWLPH ZHKDYHQRWRQO\SURGXFHGKLJKTXDOLW\WKHDWUHDWDQDIIRUGDEOHSULFHEXWZHKDYHDOVRKDGWKH RSSRUWXQLW\WRSDUWQHUZLWKDQGFRQWULEXWHWRWKHVXFFHVVRIQXPHURXVDUWLVWVWKDWFDQSURYLGHVXSSRUW DQGWHFKQLFDOH[SHUWLVHGXULQJWKHHYHQW 7KHHYHQWZLOOEHDQLPPHUVLYHHGXFDWLRQDOHYHQWIRUDOODJHVDQGDQRSSRUWXQLW\WRHQOLJKWHQWKH FRPPXQLW\DERXWWKHPDQ\EHQHILWVDQGYDOXHRIWKHDUWVLQ1HZSRUW%HDFK7KHHYHQWZLOOEHSODQQHG ODWHVSULQJRUHDUO\VXPPHU7KHHYHQWZLOOEHKHOGDW1HZSRUW7KHDWUH$UWV&HQWHULQWKHWKHDWHU IDFLOLW\DQGVXUURXQGLQJSDUN 7KHHYHQWLVRSHQWRDOOPHPEHUVRIWKHFRPPXQLW\IURPWKHDJHVRIDQGDERYH2XUSODQ LVWRFRQGXFWWKLVVHPLQDURYHURQHKRXUGD\DQGKDVWKHSRWHQWLDOWREHH[WHQGHGWRDZHHNHQGHYHQW $VWKLVLVRXUILUVWDWWHPSWWRSURYLGHDVHPLQDURIWKLVW\SHZHDUHSODQQLQJRQDQDWWHQGDQFHEHWZHHQ ILIW\DQGRQHKXQGUHGSHRSOHDQGZLOODOVRHPSOR\DSSUR[LPDWHO\WZHQW\SURIHVVLRQDOVWRFRQGXFWWKH QXPHURXVVHVVLRQVDWDQDSSUR[LPDWHFRVWRI :HZLOOKDYHVRPHFRVWDVVRFLDWHGZLWKPDUNHWLQJWKHHYHQWZKLFKZLOOEHGRQHWKURXJKVRFLDOPHGLD DQGORFDOSXEOLFDWLRQVDQGIRUWKHFRVWRIVXSSOLHVPDWHULDOVDQGIRRGEHYHUDJHV7KHDSSUR[LPDWHFRVWLV HVWLPDWHGDW $VWKHHYHQWLVSODQQHGDWRXUDFWXDOORFDWLRQQRDGGLWLRQDOFRVWVZLOOEHQHHGHGIRUIDFLOLWLHV 103 4 5. Complete the project budget form. Address only the budget for the specific project, not your annual operating budget. For multi-project proposals, please duplicate and fill out a budget for each project. Please annotate the budget at the bottom if there are details (such as a breakdown of personnel or a marketing budget) critical to the proposal. PROJECT BUDGET Funding from the City of Newport Beach Funding from Other Sources EXPENSES-Personnel Artistic Administrative Technical Production EXPENSES-Operating Facility Expense/Space Rental Marketing Production/Exhibition Expense Touring/Presentation Expense Educational Materials Transportation Equipment Other (if greater than 10%, annotate below) GRAND TOTAL 6. Describe the expected quantifiable outcomes of your project/program and how you will evaluate the results. Be very specific in addressing the ways that you will determine that your project/program met the needs that you identified and accomplishes the goals you set out to achieve (i.e. you provide 50 hours of musical instruction and instruments to the 100 children at Newport Elementary school as measured by music store rental receipts and logs of instructors.) 7KHIROORZLQJOLVWUHSUHVHQWVWKHTXDQWLI\LQJRXWFRPHV -'HWHUPLQHVSHFLILFPDUNHWLQJDYHQXHVDQGFRVWRIHDFK7UDFNQXPEHURISDUWLFLSDQWVSHU DYHQXH -7UDFNWKHWRWDOQXPEHURISDUWLFLSDQWVE\PDLOLQJDGGUHVV -7UDFNQXPEHURISDUWLFLSDQWVIRUHDFKVHVVLRQWRSLF -7UDFNDJHRISDUWLFLSDQWVIRUVHVVLRQWRSLF -7UDFNWKHQXPEHURIFRPPXQLW\PHPEHUVQHZWRWKHWKHDWHU -7UDFNKRZPDQ\HYHQWSDUWLFLSDQWVDXGLWLRQHGYROXQWHHUHGDQGRUDWWHQGHGIXWXUH SURGXFWLRQV -7UDFNVXSSRUWILQDQFLDOGRQDWLRQVDQGYROXQWHHULQJIURPSDUWLFLSDQWVRIWKHHYHQW n/a $ 0 $ 0 $ 0 $ 0 $,000.00 $,000.00 $2,000.00 $,000.00 $,000.00 $,00.00 $00.00 104 105 5 7. Attachments Requested Please do not send material in excess of what is requested; it will not be seen by the City Arts Commission. x A list of Board Members and their affiliations x A recent list of individuals, corporations and foundations that provide organizational support- not to exceed one page. x If you are a 501(c) (3) organization attach a copy of your IRS determination letter (or your fiscal agent’s) indicating tax exempt status. x One brochure and/or one press clipping. Do not send photos, videos, CDs or any other extraneous material. It will not be presented to the City Arts Commission. 8. Please complete this operating budget form for 2024/25 and 2025/26. This is not the project/program budget for which you are applying, but your overall organizational budget. You may annotate at the bottom if there are details critical to the proposal. OPERATING BUDGET 2024/25 Budget (current) 2025/26 Budget (projected) I. Income (cash only) Contributed Earned Total Income II. Expenses Program General and Administrative Marketing and Development Total Expenses III. Operating Surplus/Deficit (Income minus Expenses) IV. Fund Balance at Beginning of Year V. Accumulated Surplus (Deficit) (Add lines III and IV) VI. In-Kind Contributions (attach schedule if greater than 10% of total income) 9. I verify that the information submitted in this application is true and correct to the best of my knowledge. Name ____________________________________ Title ____________________________________ Signature __________________________________________ Date ___________________________ $90.000.00 $85,000.00 $20,000.00 $195,000.00 $23,816.00 $186,074.00 $213,850.00 $18,850.00 $25,477.68 $44,327.67 $206,000.00 $43,000.00 $249,000.00 $90,000.00 $85,000.00 $20,000.00 $195,000.00 $54,000.00 $35,000.00 $89,000.00 Managing Director 1/10/25 ____________________ ____________________ Robert J. Fetes 106 107 Adelle Yeaton Catherine Sanchez Devon Haskell Gloria Forrest Joanna Thalken Aja Bell Cathi Lawler Diana Light Gorda Ray Joanne Lombardo Al Krauza Charles Davis Diane Levin Greg Harried Jocelyne Shiromoto Alison Rubino Charles Wagster Diane Moore Greg Jacoby Jodi Moyer Alli Aier Charlie Wright Dianne Cox Hayden Macurda John Bloom Allison Aleshire Cherrill Kawakami Dianne Russell Heather Madden John Doughty Andrea Armfield Chris Stewart Don Regan Helene Chaban John Gritzmacher Andrea Roher Christina Richey Don Spargur Holland Renton John Kendall Andrew Pedroza Christina Thompson Donna Stern Hyla Berta Jon Witcher Anita Cloud Christine Reece Doreen Kress Irene Engard Joseph Cully Ann Ballenger Christopher Spencer Douglas Dickson J.D. Rangel Juan Carlos Ramos Anna Draper Christopher Trela "ŘώīīÍĲώ[ĖċŜĺĲϏ Jack Winters Judith Lang Anne Carlock Cody Meador Dr. Michael L. Marrovouniotis Jackie Fucinari Julie Clevenger Anne Lester Colin Browne Drucilla Herridge Jackie Handleman Julie Martin Anne Rawlinson Colin Rinard Duane Taylor Jackie Melbon Julie Mulzoff Anne Rodman Collette Spencer Dylan Alexander Jacqueline DuPont Carlson Karen Bagnall Annie Quinn Connie Reinglass Eileen Newman Jacqueline Kelley Karen Jordan Annie Roth Brad Avery Elan Goldman James Fryer Karla Tucker Anthony Difrancesco Craig Maier Elisa Kingsbury James Rader Karrie Daugherty Antoinette Kaplan Cristina Payan Elisabeth Syvia Jamie Czajkowski Katherine Ware Artez Truss Curt Ericson Elizabeth Hogan Jan Elliott Kathie Wolin Audrey Dixon Cynthia Lamotte Eloise Brady Jana Holmer Kathleen Chapman Audrey Galaz Cynthia Nolan Eric Pina Jane Farrell Kathleen Duffy Austin Bergquist Cynthia Smith Erin O'Conner Janeen Cunningham Kathleen Vaughan Barbara Roberts Dana Donahoo Erin Samueli Janet Wells Kathryn Fischer Barbara Steck Daniel McCarthy Erlina Appleby Janet Zaiger Kathryn LeBoye Benjamin Lohman Dave Close Ethel Sapico Janice Lysiak Kathy Artz Beverly Schauwecker David Anastas Eugenia Shepard Janie Knight Kathy Fleming Bill Stephenson David Golbeck Evan Feinman Jasmine Moini Kathy Ladd Bita Karabian David Holt Everine Weimer Jayne Armstrong Kathy Young Bobby Schultz David Hughes Felicia Reinert Jayne Lally Katie Chidister Brad Miyasato David Renton Fran Dobley jean Pierre LaFare Keiran Ohallorn Brandee Proctor David Wilson Francine Reiner Jed Moyer Kelley Wiggins Brody Fitzpatrick Dawn Flembleaux Frank King Jenice Thacker Kelli Clark Bruce Carlin Deanna Lowrey Gabriel Rivera Jennifer Bryan Kelli Garcia Bryan and Barbara Betz Debbie Fenner Gabrielle Tresler Jennifer Crisp Kelli Frankeny Bryan Cramm Debbie Miller Gail and Sorel Reisman Jeremy Bruyn Kelly Callaghan Camille Machal Deborah Carver Gary Fulks Jill Beideman Kenne Florie Carl Symons Deborrah Lugo Gary Nesbit Jill Yaoz Kenneth Jordan Carlos Rangel Debra Petty Gary Rybold Jim McAleci Kerri Hellmuth Carol Powell DeeAynn Durbin Gendele Way-Agle Jim Stanley Kerry Hedley Caroline and Hugh Logan Denis Keiser Gene Horner Jo Vandorvort Kimberly Donahue Carolyn Slayback Dennis Boyer George Oakley Joaline Stedman Kin Gadbaw Carrie Luger Slayback Dennis Bress Gigi Fusco-Meese Joan Crudgington Koen Lampaert 108 109 110 111 1 of 8 NEWPORT BEACH CITY ARTS COMMISSION 2024-25 CULTURAL ARTS GRANT APPLICATION (Applications must be typed or word-processed- you may reformat on the computer as long as it appears the same: i.e. use Times New Roman 12 point and the same pagination.) Pacific Chorale Popular Name of Organization 95-2585505 Legal Name (if different) Federal Tax ID No. 3303 Harbor Blvd., Suite E5 Mailing Address Costa Mesa 92626 City Zip Molly Buzick Pontin 805-680-0005 Contact Name Telephone molly@pacificchorale.org www.pacificchorale.org FAX E-mail Web Site Geographical Area Served: Audiences and education program participants come from Orange, L.A., & Riverside Counties. Primary venues are Segerstrom Center for the Arts in Costa Mesa, and St. Mark’s Presbyterian and Our Lady Queen of Angels in Newport Beach Have you received a City of Newport Beach Cultural Arts Grant before? YES If so, when? 2024, 2023 Year organization was founded: 1968 Number of paid staff: 8 FT/ 50 PT # of active volunteers: 150 Total amount requested: (from request line of project budget) $ 5,000 Estimated number of people in Newport Beach that the proposed project(s) will serve: 1,800 $77$&+0(17+ 112 2 of 8 CULTURAL ARTS GRANT APPLICATION 1. Briefly describe below your organization’s purpose, mission, and goals. WĂĐŝĨŝĐŚŽƌĂůĞ͛ƐǀŝƐŝŽŶŝƐƚŽŝŶƐƉŝƌĞĂůŝĨĞůŽŶŐůŽǀĞŽĨƐŝŶŐŝŶŐ͘/ƚŚĂƐďĞĞŶĂĐŽƌŶĞƌƐƚŽŶĞŽĨƚŚĞEĞǁƉŽƌƚ ĞĂĐŚĐƵůƚƵƌĂůůĂŶĚƐĐĂƉĞƐŝŶĐĞŝƚǁĂƐĨŽƵŶĚĞĚŝŶϭϵϲϴŝŶƚŚĞŽƌŽŶĂĚĞůDĂƌůŝǀŝŶŐƌŽŽŵŽĨƚŚĞŶͲĚŝƌĞĐƚŽƌ DĂƵƌŝĐĞůůĂƌĚĂŶĚ:ĂŶhŶǀĞƌƚ;ŶŽǁ:ĂŶ>ĂŶĚƐƚƌŽŵ͘Ϳ>ĞĚŶŽǁďǇƌƚŝƐƚŝĐŝƌĞĐƚŽƌZŽďĞƌƚ/ƐƚĂĚ͕ŝƚŝƐŽŶĞŽĨ ƚŚĞŵŽƐƚƌĞƐƉĞĐƚĞĚĐŚŽŝƌƐŝŶƚŚĞh͘^͕͘ĂŶĚŝƐƚŚĞƉƌŝŵĂƌǇĂƌƚŝƐƚŝĐ͕ĐŝǀŝĐ͕ĂŶĚƐŽĐŝĂůŽƵƚůĞƚĨŽƌŵŽƌĞƚŚĂŶϭϱϬ ƉƌŽĨĞƐƐŝŽŶĂůĂŶĚǀŽůƵŶƚĞĞƌƐŝŶŐĞƌƐǁŚŽĚĞǀŽƚĞŚƵŶĚƌĞĚƐŽĨŚŽƵƌƐĂŶŶƵĂůůǇƚŽĐŽŶĐĞƌƚƐŚĞĂƌĚďǇϭϲ͕ϬϬϬ ůŝƐƚĞŶĞƌƐ͘ ĂůůĞĚĂŶKƌĂŶŐĞŽƵŶƚǇ͞ƚƌĞĂƐƵƌĞ͟ǁŝƚŚĂ͞ĨƌĞƐŚǀŝĞǁƉŽŝŶƚ͟;KƌĂŶŐĞŽƵŶƚǇZĞŐŝƐƚĞƌͿ͕WĂĐŝĨŝĐŚŽƌĂůĞ ĐŽŶƚŝŶƵĞƐƚŽƌŝƐĞŝŶůŽĐĂůĂŶĚŶĂƚŝŽŶĂůƉƌŽŵŝŶĞŶĐĞ͘/ŶϮϬϮϮ͕WĂĐŝĨŝĐŚŽƌĂůĞƉƵƚKƌĂŶŐĞŽƵŶƚǇŽŶƚŚĞĐŚŽƌĂů ŵĂƉďǇǁŝŶŶŝŶŐƚŚĞ'ƌĂŵŵǇǁĂƌĚĨŽƌĞƐƚŚŽƌĂůWĞƌĨŽƌŵĂŶĐĞŽŶĂƌĞĐŽƌĚŝŶŐŽĨDĂŚůĞƌΖƐ^ǇŵƉŚŽŶǇEŽ͘ ϴǁŝƚŚƚŚĞ>͘͘WŚŝůŚĂƌŵŽŶŝĐƵŶĚĞƌ'ƵƐƚĂǀŽƵĚĂŵĞů͘dŚĞŝŶĐƌĞĂƐĞĚǀŝƐŝďŝůŝƚǇƌĞƐƵůƚĞĚŝŶŝŶǀŝƚĂƚŝŽŶƐƚŽ ƉĞƌĨŽƌŵĂƚŚŝŐŚͲƉƌŽĨŝůĞĞǀĞŶƚƐŝŶĐůƵĚŝŶŐ^ƚĂƌtĂƌƐŽŶŝŶŶĂŚĞŝŵĂŶĚƚŚĞŵĞŵŽƌŝĂůƐĞƌǀŝĐĞŽĨKĨĨŝĐĞƌ EŝĐŚŽůĂƐsĞůůĂ͕ŚĞůĚŝŶƚŚĞ,ŽŶĚĂĞŶƚĞƌ͘dŚĞƐĞ ĐŽŵŵƵŶŝƚǇƉĞƌĨŽƌŵĂŶĐĞƐǁĞƌĞǀŝĞǁĞĚďǇŵŽƌĞ ƚŚĂŶ ϮϬ͕ϬϬϬƉĞŽƉůĞůŝǀĞĂŶĚŽŶůŝŶĞ͘ /Ŷ ĂĚĚŝƚŝŽŶ ƚŽ ƉƌĞƐĞŶƚŝŶŐ ŝƚƐ ŽǁŶ ĐŽŶĐĞƌƚ ƐĞƌŝĞƐ ĞĂĐŚ ƐĞĂƐŽŶ͕ WĂĐŝĨŝĐ ŚŽƌĂůĞ ĞŶũŽǇƐ Ă ůŽŶŐͲƐƚĂŶĚŝŶŐ ƉĂƌƚŶĞƌƐŚŝƉǁŝƚŚWĂĐŝĨŝĐ^ǇŵƉŚŽŶǇ͕ĂƐǁĞůůĂƐĐŽůůĂďŽƌĂƚŝŽŶƐǁŝƚŚƚŚĞ>ŽƐŶŐĞůĞƐWŚŝůŚĂƌŵŽŶŝĐ͕,ŽůůǇǁŽŽĚ Žǁů͕ ĂŶĚ ŽƚŚĞƌ ŽƌĐŚĞƐƚƌĂƐ͘ ϮϬϮϯ ƵƌŽƉĞĂŶ ĐŽŶĐĞƌƚ ƚŽƵƌ ŝŶĐůƵĚĞĚ ƉĞƌĨŽƌŵĂŶĐĞƐ Ăƚ ƚŚĞ ^ĂůǌďƵƌŐ ĂƚŚĞĚƌĂů͕ĂƚŚďďĞǇ͕ĂŶĚƚŚĞ^ŚĞůĚŽŶŝĂŶdŚĞĂƚƌĞŝŶKǆĨŽƌĚ͘ ĞĞƉůǇĐŽŵŵŝƚƚĞĚƚŽŵĂŬŝŶŐĐŚŽƌĂůŵƵƐŝĐĂĐĐĞƐƐŝďůĞƚŽƉĞŽƉůĞŽĨĂůůĂŐĞƐ͕WĂĐŝĨŝĐŚŽƌĂůĞĂůƐŽĞŶƌŝĐŚĞƐƚŚĞ ůŽĐĂůĐŽŵŵƵŶŝƚǇďǇƉƌŽǀŝĚŝŶŐŚĂŶĚƐͲŽŶĞĚƵĐĂƚŝŽŶĂŶĚĨƌĞĞĐŽŶĐĞƌƚƚŝĐŬĞƚƐƚŽĂůŵŽƐƚϮ͕ϬϬϬůŝĨĞůŽŶŐůĞĂƌŶĞƌƐ ĞĂĐŚǇĞĂƌ͕ƚŚƌŽƵŐŚĂĨƚĞƌͲƐĐŚŽŽůĐŚŽŝƌƐĂƚůŽǁͲŝŶĐŽŵĞĞůĞŵĞŶƚĂƌǇƐĐŚŽŽůƐ͕ĂĐŚŽƌĂůƐƵŵŵĞƌĐĂŵƉĨŽƌŚŝŐŚ ƐĐŚŽŽůƐƚƵĚĞŶƚƐ͕ĂŶĚĂŶĂŶŶƵĂůĐŽŵŵƵŶŝƚǇͲǁŝĚĞĨĞƐƚŝǀĂůĨŽƌĂĚƵůƚƐŝŶŐĞƌƐĂƚZĞŶĠĞĂŶĚ,ĞŶƌǇ^ĞŐĞƌƐƚƌŽŵ ŽŶĐĞƌƚ,Ăůů͘ 2. Identify and describe why there is a need in the Newport Beach Community for your proposed project/program. Include a quantitative description of the need and on what you based your findings (i.e. “Based on a study done by the PTA, there are one hundred children in the 4th-6th grades at Newport Elementary who have had no training with musical instruments.” ) Describe how you have determined that your organization is the best organization for the proposed project/program. DĂŶǇ ŽĨ WĂĐŝĨŝĐ ŚŽƌĂůĞ͛Ɛ ƐŝŶŐĞƌƐ ĂŶĚ ƐƚƌŽŶŐĞƐƚ ƐƵƉƉŽƌƚĞƌƐ ƌĞƐŝĚĞŝŶEĞǁƉŽƌƚĞĂĐŚ͕ĂŶĚ^ƚ͘DĂƌŬ͛Ɛ WƌĞƐďǇƚĞƌŝĂŶ ŚƵƌĐŚ ŚĂƐ ďĞĞŶ Ă ƌĞŐƵůĂƌ ƌĞŚĞĂƌƐĂů ǀĞŶƵĞ ĨŽƌ ŽǀĞƌ Ă ĚĞĐĂĚĞ͘ zĞƚ ƚŚĞ ŽƉƉŽƌƚƵŶŝƚŝĞƐ ĨŽƌ ůŝƐƚĞŶĞƌƐƚŽĂƚƚĞŶĚƉƌŽĨĞƐƐŝŽŶĂůĐŚŽƌĂůƉĞƌĨŽƌŵĂŶĐĞƐǁŝƚŚŝŶƚŚĞĐŝƚǇůŝŵŝƚƐĂƌĞůŝŵŝƚĞĚ͘WĂĐŝĨŝĐŚŽƌĂůĞŚĞůƉƐ ŵĂŬĞEĞǁƉŽƌƚĞĂĐŚĂĚĞƐƚŝŶĂƚŝŽŶĨŽƌĂƵĚŝĞŶĐĞƐďǇŚŽůĚŝŶŐƚŚƌĞĞƉŽƉƵůĂƌĐŚĂŵďĞƌĐŚŽŝƌĐŽŶĐĞƌƚƐĂƚKƵƌ >ĂĚǇYƵĞĞŶŽĨŶŐĞůƐĂƚŚŽůŝĐŚƵƌĐŚ͘ĞĐĞŵďĞƌ͛Ɛ͞ĂƌŽůƐďǇĂŶĚůĞůŝŐŚƚ͕͟ŚĂƐďĞĐŽŵĞĂůŽĐĂůĨĂǀŽƌŝƚĞ ŽǀĞƌƚŚĞƉĂƐƚŶŝŶĞǇĞĂƌƐ͕ǁŝƚŚƐĞůůͲŽƵƚĐƌŽǁĚƐĞǀĞŶĂƐƚŚĞŶƵŵďĞƌŽĨƉĞƌĨŽƌŵĂŶĐĞƐǁĂƐĚŽƵďůĞĚ͘dŚĞƐĞ ĐŽŶĐĞƌƚƐ ƐƵƉƉŽƌƚ ƚŚĞ ůŽĐĂů ĂƌƚƐ ĞĐŽŶŽŵǇ ďǇ ƵƚŝůŝǌŝŶŐ EĞǁƉŽƌƚ ĞĂĐŚ ǀĞŶƵĞƐ ĂŶĚ ƉĞƌĨŽƌŵĞƌƐ͕ ĂŶĚ ďǇ ĚƌĂǁŝŶŐ ĂƵĚŝĞŶĐĞ ŵĞŵďĞƌƐ ƚŽ ƚŚĞ ĂƌĞĂ ĂƐ ĂŶ ĂƌƚƐ ĚĞƐƚŝŶĂƚŝŽŶ͘ &ƌĞĞ ĐŽŶĐĞƌƚ ƚŝĐŬĞƚƐ ĂŶĚ Ă ĨĂŵŝůŝĂƌ ŶĞŝŐŚďŽƌŚŽŽĚůŽĐĂƚŝŽŶĞĂƐĞĂĐĐĞƐƐĨŽƌEͲDh^ƐƚƵĚĞŶƚƐ͕ŵĂŶǇŽĨǁŚŽŵŵĂǇŚĂǀĞŶĞǀĞƌĂƚƚĞŶĚĞĚĂ ƉƌŽĨĞƐƐŝŽŶĂůĐŽŶĐĞƌƚďĞĨŽƌĞ͘ 113 3 of 8 3.Describe the specific project/program that will be funded by a cultural grant. Include how the proposed project/program will be implemented and outline a schedule or project timeline, with planned dates and locations. Identify individuals and groups involved, particularly artists and performers, and describe their roles and responsibilities. Describe the background and qualifications of your organization and key personnel to be involved in the program. Remember: the City funds only projects and programs- not operating expenses. These projects and programs must promote community involvement and awareness of the arts in Newport Beach. Is this a new x or existing x project/program? WĂĐŝĨŝĐŚŽƌĂůĞǁŝůůƉƌĞƐĞŶƚƚŚƌĞĞƉĞƌĨŽƌŵĂŶĐĞƐĂƚKƵƌ>ĂĚǇYƵĞĞŶŽĨŶŐĞůƐĂƚŚŽůŝĐŚƵƌĐŚŝŶϮϬϮϱ͕ůĞĚ ďǇƌƚŝƐƚŝĐŝƌĞĐƚŽƌZŽďĞƌƚ/ƐƚĂĚ͘ ƵŝůĚŝŶŐŽŶƚŚĞƐƵĐĐĞƐƐŽĨϮϬϮϯ͛ƐDŽŶƚĞǀĞƌĚŝsĞƐƉĞƌƐĂŶĚƚŚĞĐŽŶƐŝĚĞƌĂďůĞĞǆŝƐƚŝŶŐĨĂŶďĂƐĞŽĨƚŚĞĂƌŽƋƵĞ DƵƐŝĐ&ĞƐƚŝǀĂů͕WĂĐŝĨŝĐŚŽƌĂůĞ͛ƐϮϰͲǀŽŝĐĞĐŚĂŵďĞƌĐŚŽŝƌďƌĞĂƚŚĞƐůŝĨĞŝŶƚŽ,ĂŶĚĞů͛ƐŵŽŶƵŵĞŶƚĂůŽƌĂƚŽƌŝŽŝŶ ǆŽĚƵƐ͗/ƐƌĂĞůŝŶŐǇƉƚŝŶDĂƌĐŚϮϬϮϱ͘,ĂŶĚĞů͛ƐĞƉŝĐĚŽƵďůĞͲĐŚŽŝƌŽƌĂƚŽƌŝŽŝƐĂǀŝǀŝĚŵƵƐŝĐĂůĚĞƉŝĐƚŝŽŶŽĨ ƚŚĞƉůĂŐƵĞƐĂŶĚĚĂŶŐĞƌƐĨĂĐĞĚďǇDŽƐĞƐĂŶĚŚŝƐƉĞŽƉůĞĂƐƚŚĞǇĨůĞĚĨƌŽŵƐůĂǀĞƌǇ͕ǁŝƚŚƚŝŵĞůĞƐƐƚŚĞŵĞƐ ƚŚĂƚƌĞƐŽŶĂƚĞŝŶƚŚĞĐƵƌƌĞŶƚĚĂǇ͘dŚĞĐŚŽŝƌǁŝůůďĞũŽŝŶĞĚďǇƚŚĞĂĐŚŽůůĞŐŝƵŵ^ĂŶŝĞŐŽŽŶĂƌŽƋƵĞͲ ƉĞƌŝŽĚŝŶƐƚƌƵŵĞŶƚƐ͕ǁŝƚŚZƵďĞŶsĂůĞŶǌƵĞůĂŽŶŽƌŐĂŶ͘dŚĞƉĞƌĨŽƌŵĂŶĐĞǁŝůůďĞĐĂƉƚƵƌĞĚŽŶŚŝŐŚͲĚĞĨŝŶŝƚŝŽŶ ǀŝĚĞŽĨŽƌǁŝĚĞƌŵĞĚŝĂĚŝƐƚƌŝďƵƚŝŽŶ͘ ĞĐĞŵďĞƌ͛ƐĂƌŽůƐďǇĂŶĚůĞůŝŐŚƚŝƐĂĨĂǀŽƌŝƚĞŽĨůŽĐĂůƐĂŶĚǀŝƐŝƚŽƌƐƐĞĞŬŝŶŐƚŚĞŵŽƌĞƌĞĨůĞĐƚŝǀĞƐŝĚĞŽĨƚŚĞ ǁŝŶƚĞƌŚŽůŝĚĂǇƐ͘<ŶŽǁŶĨŽƌŝƚƐďĞĂƵƚŝĨƵůůǇďĂůĂŶĐĞĚƉƌŽŐƌĂŵŵŝŶŐŽĨƚƌĂĚŝƚŝŽŶĂůĂŶĚĐŽŶƚĞŵƉŽƌĂƌǇŚŽůŝĚĂǇ ŵƵƐŝĐŝŶĂƉĞĂĐĞĨƵů͕ĐĂŶĚůĞůŝƚƐĞƚƚŝŶŐ͕ƚŚŝƐŝŶƚŝŵĂƚĞĐŽŶĐĞƌƚŐŝǀĞƐǀŽŝĐĞƚŽƚŚĞǁŽŶĚĞƌ͕ƌĞǀĞƌĞŶĐĞ͕ĂŶĚĂǁĞ ŽĨƚŚĞƐĞĂƐŽŶ͘tŝƚŚĂĚĞǀŽƚĞĚĂŶĚŐƌŽǁŝŶŐĨĂŶďĂƐĞǁŚŽŚĂǀĞĐĂůůĞĚŝƚ͞ĂĐŽƵƐƚŝĐŵĂŐŝĐ͕͟ƚŚŝƐŝŵŵĞƌƐŝǀĞ ĞǆƉĞƌŝĞŶĐĞƌĞŐƵůĂƌůǇƐĞůůƐŽƵƚƚǁŽƉĞƌĨŽƌŵĂŶĐĞƐ͘'ĞŶŝĞĂǀŝƐŽĨŝǀĞƌƐŝŽŶƐ>ƌĞĐŽŵŵĞŶĚƐ͕͞ĞƐƵƌĞƚŽĂĚĚ ƚŚŝƐĂŶŶƵĂůĞǀĞŶƚƚŽǇŽƵƌŵƵƐƚͲĚŽůŝƐƚŝŶƚŚĞĨƵƚƵƌĞ͘͟ 4. Define or describe the segment of the population in Newport Beach that you intend to serve by your project/program. Include such things as age, location, numbers served, etc. ĂƐĞĚŽŶƉĂƐƚƚŝĐŬĞƚƐĂůĞƐĨŽƌƐŝŵŝůĂƌĐŽŶĐĞƌƚƐ͕ǁĞĞǆƉĞĐƚĨƵůůͲĐĂƉĂĐŝƚǇĐƌŽǁĚƐŽĨϲϱϬƉĞŽƉůĞĨŽƌĞĂĐŚŽĨƚŚĞ ƚǁŽƉĞƌĨŽƌŵĂŶĐĞƐ ŽĨĂƌŽůƐďǇĂŶĚůĞůŝŐŚƚ͕ĂŶĚŽǀĞƌϱϬϬĨŽƌǆŽĚƵƐ͘ǆƚƌĂƉŽůĂƚŝŶŐĨƌŽŵǌŝƉĐŽĚĞĂŶĚ ƉƌŽŵŽĐŽĚĞĚĂƚĂĨƌŽŵƉĂƐƚŽĨĨĞƌŝŶŐƐĂƚKƵƌ>ĂĚǇYƵĞĞŶŽĨŶŐĞůƐ͕ǁĞƉƌĞĚŝĐƚƚŚĂƚŵŽƌĞƚŚĂŶŚĂůĨŽĨ ĂƚƚĞŶĚĞĞƐǁŝůůďĞEĞǁƉŽƌƚĞĂĐŚƌĞƐŝĚĞŶƚƐĂƚƚƌĂĐƚĞĚƚŽƚŚĞůŽĐĂůǀĞŶƵĞ͕ĂŶĚƚŚĞƌĞŵĂŝŶĚĞƌǁŝůůĐŽŵĞĨƌŽŵ ŽƚŚĞƌƉĂƌƚƐŽĨKƌĂŶŐĞŽƵŶƚǇǁŝƚŚĐŽŶĐĞŶƚƌĂƚŝŽŶƐŝŶ/ƌǀŝŶĞ͕>ĂŐƵŶĂĞĂĐŚ͕ĂŶĚ&ƵůůĞƌƚŽŶ͘tĞĞǆƉĞĐƚƚŚĂƚĂ ůĂƌŐĞĐŽŶƚŝŶŐĞŶƚŽĨŽƌŽŶĂĚĞůDĂƌ͛ƐĂƌŽƋƵĞDƵƐŝĐ&ĞƐƚŝǀĂůĨĂŶƐǁŝůůďĞĚƌĂǁŶƚŽƚŚĞǆŽĚƵƐĐŽŶĐĞƌƚŝŶ ƉĂƌƚŝĐƵůĂƌ͘hƉƚŽϱϬƚŝĐŬĞƚƐĨŽƌĞĂĐŚƉƌŽŐƌĂŵǁŝůůďĞŽĨĨĞƌĞĚĨŽƌĨƌĞĞƚŽůŽĐĂůƐĐŚŽŽůƐĂŶĚƐŽĐŝĂůƐĞƌǀŝĐĞ ĂŐĞŶĐŝĞƐƚŽĞŶƐƵƌĞƚŚĂƚƉƌŝĐĞŝƐŶŽƚĂďĂƌƌŝĞƌƚŽĂĐĐĞƐƐ͘ 114 4 of 8 5. Complete the project budget form. Address only the budget for the specific project, not your annual operating budget. For multi-project proposals, please duplicate and fill out a budget for each project. Please annotate the budget at the bottom if there are details (such as a breakdown of personnel or a marketing budget) critical to the proposal. PROJECT BUDGET Funding from the City of Newport Beach Funding from Other Sources EXPENSES-Personnel Artistic $5,000 $81,570 Administrative $400 Technical Production Facility Expense/Space Rental $5,500 Marketing Production/Exhibition Expense $5,200 Touring/Presentation Expense Educational Materials Transportation Equipment Other (if greater than 10%, annotate below) GRAND TOTAL $5,000 $92,670 6. Describe the expected quantifiable outcomes of your project/program and how you will evaluate the results. Be very specific in addressing the ways that you will determine that your project/program met the needs that you identified and accomplishes the goals you set out to achieve (i.e. you provide 50 hours of musical instruction and instruments to the 100 children at Newport Elementary school as measured by music store rental receipts and logs of instructors.) WĂĐŝĨŝĐŚŽƌĂůĞǁŝůůŚŽůĚĞůĞǀĞŶƌĞŚĞĂƌƐĂůƐĂƚ^ƚ͘DĂƌŬ͛ƐWƌĞƐďǇƚĞƌŝĂŶŚƵƌĐŚ͕ĂŶĚĨŽƵƌƌĞŚĞĂƌƐĂůƐƉůƵƐ ƚŚƌĞĞƉĞƌĨŽƌŵĂŶĐĞƐĂƚKƵƌ>ĂĚǇYƵĞĞŶŽĨŶŐĞůƐ͘ŽƚŚůŽĐĂƚŝŽŶƐĂƌĞŝŶEĞǁƉŽƌƚĞĂĐŚ͘ŽŶĐĞƌƚƐǁŝůů ďĞĂƚƚĞŶĚĞĚďǇĂŶĞƐƚŝŵĂƚĞĚƚŽƚĂůĂƵĚŝĞŶĐĞŽĨϭ͕ϴϬϬůŝƐƚĞŶĞƌƐĂƐŵĞĂƐƵƌĞĚďǇƚŝĐŬĞƚƐĂůĞƐ͘tĞǁŝůů ŽĨĨĞƌƵƉƚŽϭϬϬĨƌĞĞƚŝĐŬĞƚƐƚŽEĞǁƉŽƌƚĞĂĐŚĐŚŽŝƌƐƚƵĚĞŶƚƐ͕ĨĂŵŝůŝĞƐ͕ĂŶĚƐŽĐŝĂůƐĞƌǀŝĐĞƉĂƌƚŶĞƌƐƚŽ ĞŶƐƵƌĞƚŚĂƚĐŽƐƚŝƐŶĞǀĞƌĂďĂƌƌŝĞƌƚŽĐŽŶĐĞƌƚĂƚƚĞŶĚĂŶĐĞ͘ 115 5 of 8 7. Attachments Requested x A list of Board Members and their affiliations x A recent list of individuals, corporations and foundations that provide organizational support- not to exceed one page. x If you are a 501(c) (3) organization attach a copy of your IRS determination letter (or yourfiscal agent’s) indicating tax exempt status. x One brochure and/or one press clipping. Do not send photos, videos, CDs or any other extraneous material. It will not be presented to the City Arts Commission. 8. OPERATING BUDGET 2024/25 Budget (current) 2025/26 Budget (projected) I. Income (cash only) Contributed 1,880,181 2,021,720 Earned 605,393 565,810 Total Income 2,485,574 2,587,530 II. Expenses Program 2,064,621 2,062,233 General and Administrative 374,703 326,699 Marketing and Development 264,548 261,670 Total Expenses 2,703,872 2,650,602 III. Operating Surplus/Deficit (Income minus Expenses) (218,298)(63,072) IV. Fund Balance at Beginning of Year 0 0 V. Accumulated Surplus (Deficit) (Add lines III and IV) (218,298)(63,072) VI. In-Kind Contributions (attach schedule if greater than 10% of total income)0 0 EŽƚĞ͗dŚĞŽĂƌĚŽĨŝƌĞĐƚŽƌƐŚĂƐĂƉƉƌŽǀĞĚĂϯͲǇĞĂƌĨŝŶĂŶĐŝĂůĨƌĂŵĞǁŽƌŬƚŽĞůŝŵŝŶĂƚĞƚŚĞŽƉĞƌĂƚŝŶŐĚĞĨŝĐŝƚ͘dŚĞ ĨƌĂŵĞǁŽƌŬŽƵƚůŝŶĞƐĂƚĞŵƉŽƌĂƌǇƌĞĚƵĐƚŝŽŶŝŶƚŚĞŽƌŐĂŶŝǌĂƚŝŽŶ͛ƐŽƉĞƌĂƚŝŶŐĞǆƉĞŶƐĞƐĂŶĚĂƉůĂŶƚŽƐƚĞĂĚŝůǇ ŝŶĐƌĞĂƐĞƌĞůŝĂďůĞĞĂƌŶĞĚĂŶĚĐŽŶƚƌŝďƵƚĞĚƌĞǀĞŶƵĞƐŽǀĞƌƚŚĞŶĞǆƚϯǇĞĂƌƐƚŽƵůƚŝŵĂƚĞůǇĂĐŚŝĞǀĞĂďĂůĂŶĐĞĚďƵĚŐĞƚ͘ dŽĂƐƐŝƐƚǁŝƚŚƚŚŝƐǁŽƌŬ͕WĂĐŝĨŝĐŚŽƌĂůĞŚĂƐĞŶŐĂŐĞĚ^&ƵŶĚƌĂŝƐŝŶŐŽŶƐƵůƚĂŶƚƐƚŽƐƵƉƉŽƌƚƚŚĞĚĞƐŝŐŶĂŶĚ ŝŵƉůĞŵĞŶƚĂƚŝŽŶŽĨĂƐƵƐƚĂŝŶĂďůĞŵĂũŽƌŐŝĨƚƐƉƌŽŐƌĂŵ͘tŚŝůĞƚŚĞĂƉƉƌŽǀĞĚ&zϮϱƵĚŐĞƚƐŚŽǁƐĂĚĞĨŝĐŝƚ͕ŝŶůĂƌŐĞ ƉĂƌƚĚƵĞƚŽŵŽƌĞƌĞĂůŝƐƚŝĐƌĞǀĞŶƵĞƉƌŽũĞĐƚŝŽŶƐďĂƐĞĚŽŶƉƌŝŽƌƉĞƌĨŽƌŵĂŶĐĞ͕ŝƚŝƐƚŚĞŐŽĂůŽĨƚŚĞĂĚŵŝŶŝƐƚƌĂƚŝŽŶƚŽ ŝĚĞŶƚŝĨǇĂĚĚŝƚŝŽŶĂůĞǆƉĞŶƐĞƐĂǀŝŶŐƐĂŶĚĐŽŶƚƌŝďƵƚĞĚƌĞǀĞŶƵĞŽƉƉŽƌƚƵŶŝƚŝĞƐƚŽƵůƚŝŵĂƚĞůǇĂĐŚŝĞǀĞĂďĂůĂŶĐĞĚ&zϮϱ ŽƉĞƌĂƚŝŶŐďƵĚŐĞƚ͘ 116 6 of 8 9. I verify that the information submitted in this application is true and correct to the best of my knowledge. Name Molly Buzick Pontin Title: Grants Consultant Signature Date 01/06/2025 117 7 of 8 ŽĂƌĚŽĨŝƌĞĐƚŽƌƐ ŝƌĞĐƚŽƌEĂŵĞŽŵƉĂŶǇĨĨŝůŝĂƚŝŽŶ ΎDƌ͘ƌŝĂŶĂƚĞƐ͕dƌĞĂƐƵƌĞƌW͕ĂƚĞƐŽƵŐŚƚƌǇZĞŝƐƐ Dƌ͘ĂǀŝĚƵŶŬĞƌǆĞĐƵƚŝǀĞŝƌĞĐƚŽƌ͕DǇ>ŝĨĞ&ŽƵŶĚĂƚŝŽŶ Dƌ͘ZŚĞƚƚĞůĂŵƉŽ͕WƌĞƐŝĚĞŶƚΘKWƌĞƐŝĚĞŶƚΘK͕WĂĐŝĨŝĐŚŽƌĂůĞ DƐ͘DĂƌŝĂ,ĂůůͲƌŽǁŶWƌŽĚƵĐĞƌ͕W^^ŽĂů ƌ͘ZŽďĞƌƚ/ƐƚĂĚ͕ƌƚŝƐƚŝĐŝƌĞĐƚŽƌƌƚŝƐƚŝĐŝƌĞĐƚŽƌ͕WĂĐŝĨŝĐŚŽƌĂůĞ ŝƌĞĐƚŽƌŽĨŚŽƌĂůĐƚŝǀŝƚŝĞƐ͕Ăů^ƚĂƚĞ&ƵůůĞƌƚŽŶ Dƌ͘ŚƌŝƐ>ŝŶĚůĞǇ EŽƚĞ͗ŵĂƌƌŝĞĚƚŽ^ƵƐĂŶ>ŝŶĚůĞǇWƌŝŶĐŝƉĂů͕>,&ƌĂŶĚƐ ΎDƐ͘^ƵƐĂŶ>ŝŶĚůĞǇ͕^ĞĐƌĞƚĂƌǇ EŽƚĞ͗ŵĂƌƌŝĞĚƚŽŚƌŝƐ>ŝŶĚůĞǇZĞƚŝƌĞĚ͕ĂƉŝƚĂů'ƌŽƵƉ DƌƐ͘DĂƌǇ͘>ǇŽŶƐZĞƚŝƌĞĚ͕EĞǁƉŽƌƚ,ĂƌďŽƌ,ŝŐŚ^ĐŚŽŽů Dƌ͘ZŝĐŬDĐEĞŝůƚƚŽƌŶĞǇ͕ƌŽǁĞůůΘDŽƌŝŶŐ DƌƐ͘DĂƌĐŝĂK͛,ĞƌŶWŚŝůĂŶƚŚƌŽƉŝƐƚ ΎDƌ͘dŽŵWƌŝĚŽŶŽĨĨ͕/ŵŵĞĚŝĂƚĞWĂƐƚŚĂŝƌZĞƚŝƌĞĚ͕WƌĞƐŝĚĞŶƚΘKǁŶĞƌ͕ĐĐĞŶƚWůĂƐƚŝĐƐ Dƌ͘^ƚĞƉŚĂŶĞYƵŝŶŶƚƚŽƌŶĞǇ͕KƌĂŶŐĞŽƵŶƚǇ&ĂŵŝůǇ>Ăǁ Dƌ͘ZǇĂŶZĂƚĐůŝĨĨ͕ƌƚŝƐƚƐ͛ŽƵŶĐŝůWƌĞƐŝĚĞŶƚƌĐŚŝƚĞĐƚ͕ĂƌůŝůĞŽĂƚƐǁŽƌƚŚƌĐŚŝƚĞĐƚƐ ΎDƌ͘ƌĂŝŐ^ƉƌŝŶŐĞƌ͕ŽĂƌĚŚĂŝƌWƌĞƐŝĚĞŶƚ͕/ƌǀŝŶĞĂƌĐůĂǇdŚĞĂƚĞƌ Dƌ͘DŝĐŚĂĞůsĂŶƚƌĞĂƐĞZĞƚŝƌĞĚ͕WůĂǌĂĂŶŬ DƌƐ͘:ƵůŝĞsŝƌũĞĞŝƌĞĐƚŽƌ͕zĂŵďŝZǁĂŶĚĂ DƐ͘>ŝ,ŽŶŐ;ͿtĂŶŐWŚŝůĂŶƚŚƌŽƉŝƐƚ ΎDƐ͘ŵĂŶĚĂtŚŝƚŝŶŐ͕sŝĐĞŚĂŝƌKĨĨŝĐĞ^ĞƌǀŝĐĞƐ^ƌ͘ŽŽƌĚŝŶĂƚŽƌ͕ĂƉŝƚĂů'ƌŽƵƉ DƐ͘:ĂŶ>ĂŶĚƐƚƌŽŵ͕ŝƌĞĐƚŽƌŵĞƌŝƚƵƐ DƌƐ͘:ĂŶŝĐĞ:ŽŚŶƐŽŶ͕ŝƌĞĐƚŽƌŵĞƌŝƚƵƐ ΎĚĞŶŽƚĞƐǆĞĐƵƚŝǀĞŽŵŵŝƚƚĞĞ 118 8 of 8 D:KZKEKZ^ KEKZ/E/s/h>;/Ϳ͕&KhEd/KE;&Ϳ͕ 'KsZEDEd;'͕ͿKZWKZd;Ϳ ΨϭϬϬ͕ϬϬϬн WŚŝůůŝƉE͘ĂŶĚDĂƌǇ͘>ǇŽŶƐ/ ŚĂƌůĞƐĂŶĚ>ŝŶŐŚĂŶŐ/ >ĞŶŽƌĂDĞŝƐƚĞƌΘ^ĂůƚͲǁĂǇWƌŽĚƵĐƚƐ͕/ŶĐ͘ ΨϮϱ͕ϬϬϬн ,ĂŶƐĂŶĚsĂůĞƌŝĞ/ŵŚŽĨ/ :ŽŚŶĂŶĚ>Žƌŝ>ŽĨƚƵƐ/ dƌŝƐŚKΖŽŶŶĞůů/ DĂƌĐŝĂĂŶĚĞŶŶŝƐK͛,ĞƌŶ/ dŚĞĂƉŝƚĂů'ƌŽƵƉŽŵƉĂŶŝĞƐ& ^ĞŐĞƌƐƚƌŽŵ&ŽƵŶĚĂƚŝŽŶ& ΨϭϬ͕ϬϬϬн <ĂƌůĂŶĚDĂƌŝůǇŶ&ŽƌƐƐƚƌŽŵ/ :ĂŶŝĐĞ:ŽŚŶƐŽŶ/ :ĂŶ>ĂŶĚƐƚƌŽŵ/ :ĂŵĞƐĂŶĚ<ĂƌĞŶDĐƌŝĚĞ/ dŚŽŵĂƐĂŶĚŽŶŶŝĞWƌŝĚŽŶŽĨĨ/ <ĞŶŶĞƚŚĂŶĚĂƌůĂEĞĞůĚ/ >ŽƌĂŝŶĞZĞĞĚ/ sŝŶĂtŝůůŝĂŵƐĂŶĚdŽŵ^ůĂƚƚĞƌǇ/ ŽůďƵƌŶ&ŽƵŶĚĂƚŝŽŶ& ĂůŝĨŽƌŶŝĂƌƚƐŽƵŶĐŝů' EĂƚŝŽŶĂůŶĚŽǁŵĞŶƚĨŽƌƚŚĞƌƚƐ' /ƌǀŝŶĞĂƌĐůĂǇdŚĞĂƚƌĞ Ψϱ͕ϬϬϬн DĂƌŐĂƌĞƚ'ĂƚĞƐ/ EĞůƐĂŶĚŶĚƌĞĂ<ůǇǀĞƌ/ WĞƚĞƌĂŶĚŽŶŶŝĞ<ƌĞŵĞƌ/ ŚƌŝƐĂŶĚ^ƵƐĂŶ>ŝŶĚůĞǇ/ ĞďŽƌĂŚWĂƐĂƌŽǁ/ <ŝƌƐƚĞŶĂŶĚƌĂŝŐ^ƉƌŝŶŐĞƌ/ >ŝ,ŽŶŐtĂŶŐĂŶĚŚƌŝƐƚŽƉŚĞƌŚĂŽ/ >ŽŶs͘^ŵŝƚŚ&ŽƵŶĚĂƚŝŽŶ& EĞǁƉŽƌƚĞĂĐŚƵůƚƵƌĂůƌƚƐŽŵŵŝƐƐŝŽŶ' ŽƐƚĂDĞƐĂƵůƚƵƌĂůĨĨĂŝƌƐŽŵŵŝƚƚĞĞ' 119 120 121 122 123 124 1 1(:3257%($&+&,7<$576&200,66,21 &8/785$/$576*5$17$33/,&$7,21 $SSOLFDWLRQVPXVWEHW\SHGRUZRUGSURFHVVHG\RXPD\UHIRUPDWRQWKHFRPSXWHUDVORQJDVLW DSSHDUVWKHVDPHLHXVH7LPHV1HZ5RPDQSRLQWDQGWKHVDPHSDJLQDWLRQ 3DFLILF6\PSKRQ\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB Popular Name of Organization 3DFLILF6\PSKRQ\$VVRFLDWLRQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB Legal Name (if different) Federal Tax ID No. )LWFK6XLWH BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB Mailing Address ,UYLQH&$ City Zip /XLVD&DULDJD'LUHFWRURI,QVWLWXWLRQDO*LYLQJ Contact Name Telephone /&DULDJD#3DFLILF6\PSKRQ\RUJ ZZZ3DFLILF6\PSKRQ\RUJ FAX E-mail Web Site 2UDQJH&RXQW\ Geographical Area Served Have you received a City of Newport Beach Cultural Arts Grant before?<HV If so, when?0D\ Year organization was founded Number of paid staff # of active volunteers 7RWDODPRXQWUHTXHVWHG:(from request line of project budget) (VWLPDWHGQXPEHURISHRSOHLQ1HZSRUW%HDFKWKHSURSRVHGSURMHFWVZLOOVHUYH: $77$&+0(17, 125 2 &8/785$/$576*5$17$33/,&$7,21 1. Briefly describe below your organization’s purpose, mission, and goals. 3DFLILF6\PSKRQ\¶VPLVVLRQLVWRSHUIRUPLQVSLULQJHQWHUWDLQLQJDQGKHDOLQJPXVLFFRQQHFWFRPPXQLWLHV WKURXJKGLYHUVHSURJUDPPLQJLQVSLUH\RXWKSURYLGHWKHUDSHXWLFEHQHILWVDQGSURPRWHWKHZHOOEHLQJRI WKHSHRSOHZHVHUYHLQVRXWKHUQ&DOLIRUQLD7KHRUFKHVWUD was founded in 1978 to proYLGH classical music concerts IRUWKHUHJLRQ and UHPDLQVthe largest American music ensemble formed in the last 50 years. Pacific Symphony’s VWUDWHJLForganizational goals DUH to: 1%HDYLEUDQWDQGLQFOXVLYHFXOWXUDODQFKRU UHFRJQL]HGIRUWKHSXEOLFYDOXHRILWVZRUN&XOWLYDWHDUWLVWLFYLWDOLW\DQGJURZPDUNHWVKDUHWKURXJKWKH FRQWLQXRXVHYROXWLRQRILWVZRUN)RVWHUZHOOQHVVVSDUNLQVSLUDWLRQGHHSHQVHOIDZDUHQHVVDQGQXUWXUHD ]HDOIRUOLIHWKURXJKGHHSHUSDUWLFLSDWLRQZLWKRUFKHVWUDOPXVLFLQRUGHUWROHYHUDJHSRVLWLYHHGXFDWLRQDODQG FRPPXQLW\HQJDJHPHQWRXWFRPHVDQG%XLOGLQWHUQDOFXOWXUHDQGLQVWLWXWLRQDOFDSDFLW\ 7KH6\PSKRQ\presents more than 100 performances for the public, serving 275,000 residents and visitors HDFK\HDU.(ducation and community engagement programs produce more than 3,000 distinct learning and arts participation opportunities annually. Now IXOO\UHVWRUHGIROORZLQJWKHSDQGHPLFprograms and services IXUQLVK .VWXGHQWVZLWKinteractive music enrichment through Class Act (the focus of this request)ZKLOH VHUYLQJunder-represented and vulnerable populations through the Heartstrings initiative and other specially-designed and tailored programs for residents 2. Identify and describe why there is a need LQWKH1HZSRUW%HDFK&RPPXQLW\for your proposedproject/ program. Include a quantitative description of the need and on what you based your findings (i.e.“Based on a study done by the PTA, there are one hundred children in the 4th-6th grades at NewportElementary who have had no training with musical instruments.”) Describe how you have determined thatyour organization is the best organization for the proposed project/program Class Act LVXQGXSOLFDWHGLQ2UDQJH&RXQW\SURYLGLQJPXVLFHGXFDWLRQDQGDUWVopportunities for students to learn GLUHFWO\from SURIHVVLRQDOPacific Symphony PXVLFLDQV2UFKHVWUDSOD\HUVserve as teaching artists, coaches and mentors,LQVSLULQJstudents to achieve their academic goals through music enrichment7KHSURJUDPDOVRhelpVVFKRROFKLOGUHQLPSURYHkey life skills from WKHLUPXVLFDOVWXGLHV which is proven to advance student scholastic performance. For example,VWXGLHVDW7KH&HQWHUIRU $UWV(GXFDWLRQ5HVHDUFKDW&ROXPELD8QLYHUVLW\LQFLWHGDQXPEHURIEHQHILWVLQHOHPHQWDU\DQG PLGGOHVFKRROVWXGHQWVZKLFKLQFOXGHGLPSURYHPHQWVLQFUHDWLYHWKLQNLQJDELOLWLHVFRRSHUDWLYH OHDUQLQJRULJLQDOWKRXJKWFDSDELOLW\DQGJUHDWHULQGLYLGXDOLPDJLQDWLRQ0RUHRYHUFRJQLWLYHVRXQG DQGSHUVRQDOFRPSHWHQFLHVZHUHDOVRLQFUHDVHG ,QDQGWKH1DWLRQDO6FLHQFH)RXQGDWLRQUHVHDUFKHGFRQQHFWLRQVEHWZHHQPXVLFDO LQVWUXFWLRQDQGDWWHQWLRQVSDQDQGGLVFRYHUHGWKDWPXVLFHGXFDWLRQLVDVVRFLDWHGZLWKHQKDQFHG DELOLWLHVLQPDWKFUHDWLYLW\UHDGLQJFRJQLWLRQFULWLFDOWKLQNLQJDQGFRPPXQLFDWLRQVNLOOV0XVLFKDV DOVREHHQVKRZQWRLPSURYHPRWLYDWLRQFRQFHQWUDWLRQFRQILGHQFHSRLVHDQGWHDPZRUN&ODVV$FW HQKDQFHVDUWVOHDUQLQJIRUVWXGHQWVLQWKHGLVWULFWDQGKDVKHOSHGORFDOPXVLFSURJUDPVDXJPHQWWKHLU DFWLWLYLHVSDUWLFXODUO\LQ1HZSRUW%HDFKVFKRROVClass Act is the only arts education program in Orange County which offers the expertise of Symphony-affiliated SURIHVVLRQDOmusicians. 126 3 3.Describe the specific project/program that will be funded by a cultural grant. Include how the proposed project/program will be implemented and outline a schedule or project timeline, with planned dates and locations. Identify individuals and groups involved, particularly artists and performers, and describe their roles and responsibilities. Describe the background and qualifications of your organization and key personnel to be involved in the program. Remember: the City funds only projects and programs- not operating expenses. These projects and programs must promote community involvement and awareness of the arts in Newport Beach. Is this a new_____ or existing BB;BBproject/program? *UDQWIXQGVDUHUHTXHVWHGIRUWKH&ODVV$FW0XVLF(GXFDWLRQ3URJUDPLQWZR1HZSRUW%HDFKVFKRROVLQ $QGHUVHQDQG1HZSRUW&RDVW(OHPHQWDU\6FKRROV)RU\HDUV&ODVV$FWKDVPHWWKHQHHGIRU SURIHVVLRQDOPXVLFHGXFDWLRQWRKHOS2UDQJH&XQW\VFKRROVEROVWHUVWXGHQWVFKRODVWLFDFKLHYHPHQW &ODVV$FWWUDLQVDQGSODFHV3DFLILF6\PSKRQ\XQLRQPXVLFLDQVLQWRVFKRROVZKHUHVWXGHQWVUHFHLYH PHDQLQJIXOPXVLFOHDUQLQJIURPWHDFKLQJDUWLVWVLQWKHFODVVURRP7KURXJK\HDUORQJUHVLGHQFLHVLQHDFK VFKRROPXVLFLDQVIRFXVRQWKHIXQGDPHQWDOVRIPXVLFWKURXJKDJHDSSURSULDWHFODVVURRPLQVWUXFWLRQ RQVLWHVFKRROSHUIRUPDQFHVDQGDWULSWRWKHFRQFHUWKDOOIRUDIXOO3DFLILF6\PSKRQ\SHUIRUPDQFH &ODVV$FWUXQVIURP6HSWHPEHUWR-XQHHDFK\HDUZLWKVWXGHQWSDUWLFLSDWLRQEHJLQQLQJLQ1RYHPEHU 7KHSURJUDPVWDIIGHVLJQV&RPPRQ&RUHFXUULFXOXPEDVHGZRUNVKRSPDWHULDOVDQGOHVVRQSODQVXVLQJ DWKHPHDQGFRPSRVHUHDFK\HDULV³5HYROXWLRQDU\´ZLWK/XGZLJYDQ%HHWKRYHQ0DWHULDOVDUH GHOLYHUHGWRFODVVURRPWHDFKHUVGXULQJSURIHVVLRQDOGHYHORSPHQWDQGWUDLQLQJZRUNVKRSVZKHUHWKH\ OHDUQWRLQWHJUDWHPXVLFLQWRDOODUHDVRIOHDUQLQJ,QSHUVRQVWXGHQWDFWLYLWLHVDQGZRUNVKRSVUXQ WKURXJKRXWWKHDFDGHPLF\HDUDQG<RXWK&RQFHUWVDUHSUHVHQWHGLQ0D\$VVHVVPHQWVDQGHYDOXDWLRQV DUHFRQGXFWHGGXULQJDQGDIWHUDOOVWXGHQWDFWLYLWLHV6WDIIPHDVXUHVSURJUDPHIIHFWLYHQHVVWKURXJKRXW WKH\HDUWRPRQLWRUVWXGHQWSURJUHVVDQGWRHQVXUHRXWFRPHVDQGJRDOVDUHPHW &ODVV$FWHQJDJHVWKHHQWLUHVWXGHQWERG\DWERWK$QGHUVHQDQG1HZSRUW&RDVWDVZHOODVWHDFKHUVDQG SULQFLSDOVSDUHQWVDGPLQLVWUDWRUVDQGYROXQWHHUVDOVRSDUWLFLSDWH7KHUHDUHVHYHQPXVLFLDQVZKRVHUYH WKLUWHHQVFKRROVLQWKHIXOO&ODVV$FWSURJUDPDFURVVWKHFRXQW\ZLWKVFKRROVDVVLJQHGD GLIIHUHQWPXVLFLDQHDFK\HDU7KHSURJUDPLVOHGE\'LUHFWRURI(GXFDWLRQ/HLJKDQQD6HDUVZKRMRLQHG WKHVWDIILQDQGOHDGVDWHDPRIVHYHQZKRPDQDJHDQGRYHUVHHDOOSURJUDPFRPSRQHQWV VFKHGXOLQJDQGDFWLYLWLHV6LQFHLWVLQFHSWLRQ&ODVV$FWKDVVHUYHGPRUHWKDQVWXGHQWVWHDFKHUV DQGSULQFLSDOVLQ2UDQJH&RXQW\RYHUD\HDUKLVWRU\ 4. Define or describe the segment of the population in Newport Beach that you intend to serve by your project/program. Include such things as age, location, numbers served, etc. In 202,&ODVV$FWZLOOVHUYHFKLOGUHQLQWZR1HZSRUW%HDFKHOHPHQWDU\VFKRROV$QGHUVHQZLWK VWXGHQWVDQG1HZSRUW&RDVWZLWKVWXGHQWVWRJHWKHUZLWKWHDFKHUVDQGSULQFLSDOV WRWDO(DFKVFKRROVHUYHV.LQGHUJDUWHQWRWKJUDGHVWXGHQWVDJHV%RWKVFKRROVKDYHHDFK SDUWQHUHGZLWK&ODVV$FWIRUVL[WHHQQRQFRQVHFXWLYH\HDUVDQGKDYHVHHQJUHDWSURJUHVVLQWKHLU VWXGHQWVZLWKWKHDVVLVWDQFHRIJUDQWVXSSRUWIURPWKH1HZSRUW%HDFK&LW\$UWV&RPPLVVLRQ 127 4 5. Complete the project budget form. Address only the budget for the specific project, not your annual operating budget. For multi-project proposals, please duplicate and fill out a budget for each project. Please annotate the budget at the bottom if there are details (such as a breakdown of personnel or a marketing budget) critical to the proposal. 352-(&7%8'*(7 )XQGLQJIURPWKH )XQGLQJIURP (;3(16(63HUVRQQHO &LW\RI1HZSRUW%HDFK 2WKHU6RXUFHV Artistic 2,00 ,000 Administrative 1,000 0 Technical Production 1,00 ,00 (;3(16(62SHUDWLQJ Facility Exp./Space Rental Marketing Production/Exhibition Expense Touring/Presentation Expense Educational Materials Transportation Equipment Other (if greater than 10%, annotate below) *5$1'727$/ 6. Describe the expected TXDQWLILDEOH outcomes of your project/program and how you will evaluate the results. Be very specific in addressing the ways that you will determine that your project/program met the needs that you identified and accomplishes the goals you set out to achieve (i.e. you provide 50 hours of musical instruction and instruments to the 100 children at Newport Elementary school as measured by music store rental receipts and logs of instructors.) The overall desired outcome is for K-6 HOHPHQWDU\VFKRROchildren to improve WKHLUacademic achievement through the Class Act music education program. The overarching outcome for educators is to improve their music aptitude in order to teach the arts more effectively, and augment student learning in music. The quantifiable outcomes for Newport Beach students and teachers are: D $WRWDORIRURIWKHHVWLPDWHGVWXGHQWVZLOOGHPRQVWUDWHLQFUHDVHGNQRZOHGJHDERXW WKH&ODVV$FWFRPSRVHURIWKH\HDUDQGWKHLUPXVLF2XWFRPHVDUHPHDVXUHGWKURXJKSUHDQG SRVWSURJUDPWHVWLQJTXHVWLRQQDLUHVDQGWHDFKHUVXUYH\V EA total of students out of will express D desire to FRQWLQXHWRengage in music and the arts, representing % of all Class Act students. Results are quantified through pre- and post- program surveys, along with parent/teacher comments and feedback, and student enrollment in subsequent music and arts programs. FA total of 8% or of the Class Act teachers will increase their capacity to teach the arts more effectively LQWKHFODVVURRPand better support the Common Core The results aremeasured from teacher and principal surveys, individual interviews, one-on-one follow-up andin-person meetings with teachers. 128 5 7. Attachments Requested Please do not send material in excess of what is requested; it will not be seen by the City Arts Commission. x A list of Board Members and their affiliations x A recent list of individuals, corporations and foundations that provide organizational support- not to exceed one page. x If you are a 501(c) (3) organization attach a copy of your IRS determination letter (or your fiscal agent’s) indicating tax exempt status. x 2QH brochure and/or RQH press clipping. Do not send photos, videos, CDs or any other extraneous material. It will not be presented to the City Arts Commission. 8. Please complete this operating budget form for 202/202 and 202/202. This is not the project/program budget for which you are applying, but your overall organizational budget. You may annotate at the bottom if there are details critical to the proposal. 23(5$7,1*%8'*(7 %XGJHWFXUUHQW%XGJHWSURMHFWHG ,,QFRPHFDVKRQO\ Contributed Earned 7RWDO,QFRPH ,,([SHQVHV Program General and Administrative Marketing and Development 7RWDO([SHQVHV ,,,2SHUDWLQJ6XUSOXV'HILFLW (Income minus Expenses) ,9)XQG%DODQFHDW%HJLQQLQJ RI<HDU 9$FFXPXODWHG6XUSOXV 'HILFLW (Add lines III and IV) 9,,Q.LQG&RQWULEXWLRQV (attach schedule if greater than 10% of total income) Notes:'HVSLWHPDNLQJDUHPDUNDEOHUHFRYHU\IROORZLQJWKHSDQGHPLFZLWKORVVRIWLFNHWLQFRPH DQGHDUQHGUHYHQXHWKH6\PSKRQ\ VDFFXPXODWHGGHILFLWUHPDLQVDVGHEWLVVORZO\UHGXFHG 9. I verify that the information submitted in this application is true and correct to the best of my knowledge. Name Luisa Cariaga ______ Title Director of Institutional Giving Signature___LLuisa Cariaga___________________________ Date January 129 Board of Directors 2024-25 *Sally Anderson Community Leader and Arts Patron *Susan Anderson Board Vice Co-Chair Development/Philanthropist *Leona Aronoff-Sadacca Founder, Gate City Beverage Co. (retired) Lindsay A. Ayers Partner, Carothers DiSante Freudenberger LLP Richard Bridgford Attorney, Bridgford, Gleason & Artinian LLP Eric B. Chamberlain Senior Vice President, Bank of America *Jo Ellen Chatham SoCal Edison (retired) Patrick Chen President, JETCC Investments *Carol Choi President, United Exchange Corporation Alayne Cortes VP, Senior Relationship Strategist, PNC Private Bank Robert F. Davey Retired aerospace engineer Ginny Davies Community Leader and Arts Patron William Dolan Senior Vice President, U.S. Bank Lucy Dunn CEO Emeritus, Orange County Business Council Cynthia Ellis Musician Representative to the Board of Directors *John R. Evans Immediate Past Board Chair/Wells Fargo Bank (retired) *John E. Forsyte President, Pacific Symphony *Barbara Foster President, Insights Worldwide Maria Francis Community Leader and Arts Patron *Michael S. Gordon Vice-Chairman, First Q Capital Nick Guanzon-Greenko Chief Financial Officer, Tangram Interiors Andy Hanson Attorney, Sherry Meyerhoff Hanson Crance Janine Heft Councilwoman, City of Laguna Hills (Representing ACC-OC) Arnold Holland Dean, College of the Arts, California State University Fullerton Michelle M. Horowitz Community Leader and Arts Patron James Newton Howard Owner, JNH Studios Donald Hu Founder and CEO, JDH Pacific *Jerry Huang Senior VP, General Counsel & Corp. Secretary, Vizio Inc. Reza Jahangiri Founder and CEO, American Advisors Group (AAG) *Seth R. Johnson Community Leader and Arts Patron Edward Kim, M.D. Physician-in-Chief, City of Hope Johanna Kim Founder and President, Kerymen LLC *Joann Leatherby President, Leatherby Foundation Agnes Lew Wealth Management Director, East West Bank Robin Liu President, Cabinetry 1 Inc. *Phillip N. Lyons Pinecreek Investment Company *Diana Martin Board Vice Co-Chair Development/Diana Martin Gifts 130 Pacific Symphony Board of Directors Page Two *Patricia McAuley Community Leader and Arts Patron David V. Melilli President, David Melilli Company Louise Merage President, Louise Merage Family Foundation László Mezö Musician Representative to the Board of Directors Abbas Mohaddes President and COO, Econolite Haydee Mollura Community Leader and Arts Patron Maurice Murray Executive Director, J.P.Morgan Private Bank Tawni Nguyen Fiduciary Advisor, Merrill Lynch Wealth Management Stacey E. Nicholas Philanthropist, Opus Foundation *Mark Nielsen Board Treasurer/Executive Chairman, TextPower, Inc. *Arthur Ong Board Chair/Executive VP and Legal Counsel, PIMCO David A. Ontko Chief Deputy Counsel, Disneyland Resorts *Anoosheh Oskouian President, Ship & Shore Environmental, Inc. Karin Pearson Senior Vice President, Capital Group John B. Peller Community Leader and Arts Patron *Judith Posnikoff Managing Director, Martlet Asset Management, LLC Michelle Rohé Community Leader and Arts Patron *Chiyo Rowe Community Leader and Arts Patron Robert Schumitzky Musician Representative to the Board of Directors Scott Seigel President, California Closets Evan B. Siegel President and CEO, Ground Zero Pharmaceuticals Hon. Warren H. Siegel Orange County Superior Court Judge (retired) Ron Simon RSI Holding Corporation Steven M. Sorenson, M.D. Special Representative from the Segerstrom Center Al Spector Real Estate Investor and Restaurateur Walter Stahr Author and Community Leader *Andria Strelow Board Secretary/Community Leader and Arts Patron *M.C. Sungaila Partner, Complex Appellate Litigation Group *CarolAnn Tassios Community Leader and Arts Patron Andy Thorburn Community Leader and Arts Patron *Christopher Tower Community Leader, Sustainability Champion and Arts Patron David H. Troob Chief Executive, Troob Capital Management *Bart Van Aardenne Managing Member, Terranet Framroze Virjee President, AGB W. Henry Walker President, Farmers & Merchants Bank *Judy Whitmore Community Leader and Arts Patron Nancy Wong Real Estate Investor Jane Fujishige Yada Owner, Fujishige Farms, Inc. Charles Zhang Principal Founder, Zion Enterprises LLC Officers in Bold *Executive Committee Rev. 11/21/2024 131 Pacific Symphony Institutional Support 2023-24 ($25,000 and above) for fiscal year ending June 30, 2024 Foundations and Corporations 2023-24 Hal and Jeanette Segerstrom Family Foundation 1,000,000$ Lyons Share Foundation 530,000$ Schwab Charitable Fund 514,900$ Ahmanson Charitable Community Trust 360,000$ Bank of America/BofA Foundation/Charitable Gift Fund 265,000$ Zion Charity Foundation 236,000$ William and Nancy Thompson Foundation 210,000$ Joe MacPherson Foundation 200,000$ The Nicholas Endowment 154,000$ City of Hope 153,000$ California Community Foundation 152,500$ Orange County Community Foundation 150,000$ Fidelilty Charitable Gift Fund 150,000$ Henry & Elizabeth Segerstrom Charitable Foundation 150,000$ Wells Fargo Advisors 148,050$ Farmers and Merchants Bank 131,000$ US Charitable Gift Trust 130,000$ Simon Foundation for Education 125,000$ The Segerstrom Foundation 120,000$ Chapman University 112,880$ Lugano Diamonds 110,000$ Janet Curci Family Foundation 100,000$ Jewish Community Foundation of Orange County 100,000$ The UCI Foundation 80,000$ U.S. Bank/U.S. Bancorp Foundation 69,000$ Hanson Family Foundation 62,000$ SchoolsFirst Federal Credit Union 55,000$ National Christian Foundation California 55,000$ The Capital Group Companies 53,000$ The Colburn Foundation 50,000$ Hon Investments 50,000$ Isidore and Penny Myers Foundation 45,181$ East West Bank 40,000$ National Financial Services 38,000$ Argyros Family Foundation 35,000$ Wilfred and Janet Roof Foundation 35,000$ Horowitz Management, Inc.30,000$ Starland Enterprises 30,000$ UHL and KK Foundation 30,000$ Morgan Stanley 30,000$ South Coast Chinese Cultural Association 30,000$ Mark Chapin Johnson Foundation 30,000$ Loftus Family Foundation 30,000$ Ibex Foundation 25,000$ Huang Family Foundation 25,000$ Troob Family Foundation 25,000$ Green Foundation 25,000$ Ernest and Irma Rose Foundation 25,000$ Total 6,304,511$ 132 133 134 135 1 NEWPORT BEACH CITY ARTS COMMISSION 2024-25 CULTURAL ARTS GRANT APPLICATION (Applications must be typed or word-processed- you may reformat on the computer as long as it appears the same: i.e. use Times New Roman 12 point and the same pagination.) Popular Name of Organization Legal Name (if different) Federal Tax ID No. Mailing Address City Zip _____________________________________________________________________________________ Contact Name Telephone _____________________________________________________________________________________ Fax E-mail Web Site Geographical Area Served _Have you received a City of Newport Beach Cultural Arts Grant before? If so, when? ________ 1XPHURXVJUDQWVEHJLQQLQJGHFDGHVDJRPRVWUHFHQWO\LQDQG Year organization was founded Number of paid staff _____ # of active volunteers ___ ___ Total amount requested:(from request line of project budget)$ Estimated number of people in Newport Beach that the proposed project(s) will serve::H HVWLPDWHWKDWDSSUR[LPDWHO\UHVLGHQWVRI1HZSRUW%HDFKZLOODWWHQGSHUIRUPDQFHVVHH UHVSRQVHWRTXHVWLRQ South Coast Repertory (SCR) South Coast Repertory, Inc 95-6122708 655 Town Center Drive, PO Box 2197 Costa Mesa 92628-2197 Clare Kiklowicz (714) 708-5521 714-708-5529 scr.orgclare@scr.org Orange County, CA 1964 97 200 5000 yes $77$&+0(17- 136 2 CULTURAL ARTS GRANT APPLICATION 1. Briefly describe below your organization’s purpose, mission, and goals. 2. Identify and describe why there is a need in the Newport Beach Community for your proposedproject/program. Include a quantitative description of the need and on what you based your findings (i.e. “Based on a study done by the PTA, there are one hundred children in the 4th-6th grades at Newport Elementary who have had no training with musical instruments.” ) Describe how you have determined that your organization is the best organization for the proposed project/program. )RXQGHGRYHU\HDUVDJR6RXWK&RDVW5HSHUWRU\6&5KDVEHFRPHDOHDGLQJIRUFHLQ$PHULFDQWKHDWUH GHGLFDWHGWRH[SORULQJKXPDQH[SHULHQFHVWKURXJKG\QDPLFDQGLQQRYDWLYHSHUIRUPDQFHV.QRZQIRULWV GLYHUVHUHSHUWRLUH6&5SUHVHQWVFODVVLFZRUNVFRQWHPSRUDU\SLHFHVDQGEROGQHZSOD\VZLWKDVWURQJ HPSKDVLVRQFRPPLVVLRQLQJDQGGHYHORSLQJQHZZRUNV7KH/DE#6&5ZKLFKKDVVXSSRUWHGRYHU FRPPLVVLRQVDQGWKH3DFLILF3OD\ZULJKWV)HVWLYDODNH\SODWIRUPIRUQHZSOD\GHYHORSPHQWH[HPSOLI\6&5¶V FRPPLWPHQWWRIRVWHULQJHPHUJLQJYRLFHVDQGSURGXFLQJZRUOGSUHPLHUHV 6&5LVDOVRFRPPLWWHGWRLQFOXVLYLW\DFWLYHO\SULRULWL]LQJWKHYRLFHVRIZRPHQDQGDUWLVWVRIFRORULQLWV SURJUDPPLQJ7KURXJKFROODERUDWLRQVZLWKRUJDQL]DWLRQVOLNHWKH)DUKDQJ)RXQGDWLRQDQGWKH/*%74&HQWHU RI2&6&5VWUHQJWKHQVLWVFRQQHFWLRQWR2UDQJH&RXQW\¶VGLYHUVHFXOWXUDOFRPPXQLW\$GGLWLRQDOO\6&5KDV H[SDQGHGLWVIRFXVWRLQFOXGHPXVLFDOWKHDWUHZLWKSODQVWRIHDWXUHDWOHDVWRQHPXVLFDOSURGXFWLRQDQQXDOO\DW WKH3DFLILF3OD\ZULJKWV)HVWLYDO$ORQJVLGHLWVDUWLVWLFHQGHDYRUV6&5HQJDJHVWKHFRPPXQLW\WKURXJK HGXFDWLRQDOSURJUDPVVXFKDV7KHDWUHIRU<RXQJ$XGLHQFHVDQGWKH6&57KHDWUH&RQVHUYDWRU\SURYLGLQJ DFFHVVWRWKHDWUHIRUDOODJHVDQGEDFNJURXQGV /RRNLQJDKHDG6&5UHPDLQVIRFXVHGRQDGYDQFLQJWKHDUWRIWKHDWUHZKLOHIRVWHULQJDQLQFOXVLYHYLEUDQW FXOWXUDOODQGVFDSH7KURXJKLQLWLDWLYHVOLNHWKH3LQQDFOH&RPPLVVLRQZKLFKVXSSRUWVVLJQLILFDQWSOD\ZULJKWV OLNH%UDQGHQ-DFREV-HQNLQV6&5FRQWLQXHVWREXLOGODVWLQJDUWLVWLFUHODWLRQVKLSVDQGSXVKWKHERXQGDULHVRI DUWLVWLFH[FHOOHQFH 6LQFHLWVIRXQGLQJLQ6RXWK&RDVW5HSHUWRU\KDVEHHQDYLWDOFXOWXUDOLQVWLWXWLRQLQ2UDQJH&RXQW\ SURYLGLQJKLJKTXDOLW\DUWVHGXFDWLRQDQGOLYHWKHDWUHH[SHULHQFHVWKDWHQULFKORFDOFRPPXQLWLHVLQFOXGLQJ 1HZSRUW%HDFK'HVSLWHWKHDUHD¶VDIIOXHQFHWKHUHLVDVLJQLILFDQWQHHGIRUDFFHVVLEOHDUWVHGXFDWLRQDQGWKHDWUH RSSRUWXQLWLHVSDUWLFXODUO\IRUXQGHUUHSUHVHQWHG\RXWKLQ1HZSRUW%HDFKDQGWKHVXUURXQGLQJDUHDV7KH 1HZSRUW0HVD8QLILHG6FKRRO'LVWULFWVHUYHVDJURZLQJQXPEHURIORZLQFRPHVWXGHQWVZLWKQHDUO\ TXDOLI\LQJIRUIUHHRUUHGXFHGSULFHOXQFKKLJKOLJKWLQJWKHGHPDQGIRUDUWVSURJUDPPLQJWKDWLVERWKDIIRUGDEOH DQGLPSDFWIXO 6&5¶VHGXFDWLRQSURJUDPVVXFKDV7KHDWUHIRU<RXQJ$XGLHQFHV7<$7KHDWUH$FFHVVDQG0\6WDJHDLPWR DGGUHVVWKHVHQHHGVE\RIIHULQJIUHHRUGLVFRXQWHGWLFNHWVDQGHGXFDWLRQDOUHVRXUFHVWRXQGHUVHUYHGVWXGHQWV 7KURXJKWKHVHLQLWLDWLYHV6&5KDVSURYLGHGRYHUIUHHWLFNHWVDQQXDOO\WRORFDOVFKRROVLQFOXGLQJWKRVHLQ 1HZSRUW%HDFKDQGVHUYHGPRUHWKDQVWXGHQWVWKURXJK7<$LQWKHVHDVRQ6&5¶VH[SHULHQFHLQ GHOLYHULQJDFFHVVLEOHKLJKTXDOLW\DUWVHGXFDWLRQ²FRXSOHGZLWKLWVHVWDEOLVKHGSDUWQHUVKLSVZLWKVFKRROVDQG FRPPXQLW\RUJDQL]DWLRQV²PDNHVLWXQLTXHO\HTXLSSHGWRPHHWWKHQHHGVRIWKH1HZSRUW%HDFKFRPPXQLW\ 6&5¶VFRPPLWPHQWWRIRVWHULQJFUHDWLYLW\FROODERUDWLRQDQGFULWLFDOWKLQNLQJWKURXJKWKHDUWVHQVXUHVWKDW VWXGHQWVIURPGLYHUVHEDFNJURXQGVFDQHQJDJHZLWKDQGEHQHILWIURPOLYHWKHDWUH :LWKRYHUVL[GHFDGHVRIH[SHULHQFHDQGDWUDFNUHFRUGRIVXFFHVVIXOFRPPXQLW\SDUWQHUVKLSV6&5LVLGHDOO\ SRVLWLRQHGWRH[SDQGDUWVDFFHVVDQGHGXFDWLRQLQ1HZSRUW%HDFK,WVRQJRLQJGHGLFDWLRQWRPDNLQJWKHDWUH DFFHVVLEOHWRDOOSDUWLFXODUO\XQGHUVHUYHG\RXWKPDNHV6&5WKHEHVWRUJDQL]DWLRQWRDGGUHVVWKHUHJLRQ¶VDUWV HGXFDWLRQFKDOOHQJHV137 3 3. Describe the specific project/program that will be funded by a Cultural Arts Grant. Include how the proposed project/program will be implemented and outline a schedule or project timeline, with planned dates and locations. Identify individuals and groups involved, particularly artists and performers, and describe their roles and responsibilities. Describe the background and qualifications of your organization and key personnel to be involved in the program. Remember: the City funds projects and programs only - not operating expenses. These projects and programs must promote community involvement and awareness of the arts in Newport Beach. 4.Define or describe the segment of the population in Newport Beach that you intend to serve by your SURMHFWSURJUDP,QFOXGHVXFKWKLQJVDVDJHORFDWLRQQXPEHUVVHUYHGHWF Is this a new_____ or existing __;_ _ project/program? 6RXWK&RDVW5HSHUWRU\¶V7KHDWUHIRU<RXQJ$XGLHQFHVSURJUDPDFRUQHUVWRQHRILWVHGXFDWLRQDORXWUHDFKVLQFH LQWURGXFHV\RXQJDXGLHQFHVWRWKHWUDQVIRUPDWLYHSRZHURIOLYHWKHDWUH,QWKHVHDVRQ6&5VHHNV D&XOWXUDO$UWV*UDQWWRVXSSRUW7KH,QFUHGLEOH%RRN(DWLQJ%R\DIDPLO\PXVLFDOWKDWFHOHEUDWHVWKHMR\VRI UHDGLQJDQGNQRZOHGJH7KHSURGXFWLRQIHDWXULQJSHUIRUPDQFHVIURP)HE0DUFKLQFOXGHVIUHH VFKRROGD\PDWLQHHVKRZVIRUORFDOVWXGHQWVSDUWLFXODUO\IURP7LWOHVFKRROV6&5ZLOOFRQWLQXHRIIHULQJEXV WUDQVSRUWDWLRQVXEVLGLHVWRHQVXUHDFFHVVIRUVWXGHQWVIURPHFRQRPLFDOO\GLVDGYDQWDJHGEDFNJURXQGV (DFK7<$SURGXFWLRQLVKHOGWRWKHVDPHSURIHVVLRQDOVWDQGDUGVDV6&5¶VDGXOWSHUIRUPDQFHVZLWKKLJK TXDOLW\SURGXFWLRQYDOXHVDQGHGXFDWLRQDOUHVRXUFHVVXFKDVVWXG\JXLGHVDQGSURJUDPERRNOHWV7KHVH UHVRXUFHVKHOSLQWHJUDWHWKHWKHPHVRIWKHSOD\LQWRFODVVURRPOHDUQLQJHQULFKLQJVWXGHQWV HGXFDWLRQDO H[SHULHQFHV,QWKHVHDVRQRYHUVWXGHQWVIURP1HZSRUW%HDFKLQFOXGLQJWKRVHIURP7LWOH VFKRROVSDUWLFLSDWHGLQ7<$PDWLQHHVDQG6&5H[SHFWVVLPLODURULQFUHDVHGHQJDJHPHQWLQWKHIXWXUH%\ RIIHULQJIUHHWLFNHWVDQGWUDQVSRUWDWLRQ6&5PDNHVVXUHWKDW\RXQJSHRSOHIURPDOOEDFNJURXQGVFDQ H[SHULHQFHWKHPDJLFRIOLYHWKHDWUHIRVWHULQJFUHDWLYLW\LPDJLQDWLRQDQGDOLIHORQJDSSUHFLDWLRQIRUWKHDUWV 6&5¶VGHGLFDWLRQWRSURYLGLQJDFFHVVLEOHKLJKFDOLEHUWKHDWUHH[SHULHQFHVPDNHVLWWKHLGHDORUJDQL]DWLRQIRU WKLVSURJUDP:LWKDIRFXVRQERWKDUWLVWLFH[FHOOHQFHDQGHGXFDWLRQDORXWUHDFK6&5¶V7<$SURJUDPSOD\VD YLWDOUROHLQFXOWLYDWLQJIXWXUHJHQHUDWLRQVRIWKHDWUHORYHUVDUWLVWVDQGFULWLFDOWKLQNHUV )RUWKHVHDVRQ6RXWK&RDVW5HSHUWRU\¶V7KHDWUHIRU<RXQJ$XGLHQFHV7<$SURJUDPZLOOFRQWLQXHLWV FRPPLWPHQWWRSURYLGLQJDFFHVVWRKLJKTXDOLW\DUWVHGXFDWLRQIRU\RXQJDXGLHQFHVSDUWLFXODUO\VWXGHQWVIURP XQGHUVHUYHGFRPPXQLWLHV7KH7<$SURGXFWLRQRI7KH,QFUHGLEOH%RRN(DWLQJ%R\ZLOOEHRIIHUHGIUHHRI FKDUJHWRHOHPHQWDU\VFKRROVZLWKLQWKH1HZSRUW0HVD8QLILHG6DQWD$QD8QLILHGDQG*DUGHQ*URYH8QLILHG 6FKRRO'LVWULFWV$GGLWLRQDOO\SDLGSHUIRUPDQFHVZLOOEHDYDLODEOHWRDOOPHPEHUVRIWKHJHQHUDOSXEOLF HQVXULQJEURDGDFFHVVWRWKHDUWV 7KLV\HDUZHDQWLFLSDWHVHUYLQJDSSUR[LPDWHO\LQGLYLGXDOVWKURXJK7<$SHUIRUPDQFHV$WWKHWLPHRIWKLV SURSRVDOZHKDYHUHVHUYDWLRQVIURP1086'WRWKHIUHHVWXGHQWPDWLQHHV7KH7<$SURJUDPGLUHFWO\ WDUJHWV\RXQJSHRSOHLQJUDGHV.ZLWKDSDUWLFXODUHPSKDVLVRQWKRVHIURP7LWOHVFKRROVZKRPD\QRW RWKHUZLVHKDYHWKHRSSRUWXQLW\WRH[SHULHQFHOLYHWKHDWUH/DVW\HDUDSSUR[LPDWHO\RI7<$DWWHQGHHVFDPH IURPHFRQRPLFDOO\GLVDGYDQWDJHGEDFNJURXQGVDQGZHH[SHFWWKDWWRFRQWLQXHLQWKHXSFRPLQJVHDVRQ :LWKDIRFXVRQFUHDWLQJDQLQFOXVLYHDQGDFFHVVLEOHH[SHULHQFH6&5¶V7<$SURJUDPFRQWLQXHVWRVHUYHQRW RQO\VWXGHQWVLQWKH1HZSRUW0HVDGLVWULFWEXWDOVRWKHEURDGHUFRPPXQLW\7KURXJKERWKIUHHVFKRROGD\ PDWLQHHVDQGDIIRUGDEOHSXEOLFSHUIRUPDQFHV7<$VHHNVWRUHDFKFKLOGUHQIDPLOLHVDQG\RXQJDGXOWVLQ 1HZSRUW%HDFK 138 4 5. Complete the project budget form. Address only the budget for the specific project, not your annual operating budget. For multi-project proposals, please duplicate and fill out a budget for each project. Please annotate the budget at the bottom if there are details (such as a breakdown of personnel or a marketing budget) critical to the proposal. PROJECT BUDGET Funding from the City of Newport Beach Funding from Other Sources EXPENSES-Personnel Artistic Administrative Technical Production EXPENSES-Operating Facility Expense/Space Rental Marketing Production/Exhibition Expense Touring/Presentation Expense Educational Materials Transportation Equipment Other (if greater than 10%, annotate below) GRAND TOTAL 6. Describe the expected quantifiable outcomes of your project/program and how you will evaluate the results. Be very specific in addressing the ways that you will determine that your project/program met the needs that you identified and accomplishes the goals you set out to achieve (i.e. you provide 50 hours of musical instruction and instruments to the 100 children at Newport Elementary school as measured by music store rental receipts and logs of instructors.) $512,000 $5,000 $171,000 $112,000 $113,000 $11,000 $42,000 $15,000 $43,000 n/a (included in marketing expenses) included in production expenses) (ticket subsidies) $5,000 (royalties) (bus subsidies) 6RXWK&RDVW5HSHUWRU\¶V7KHDWUHIRU<RXQJ$XGLHQFHVSURJUDPIRUWKHVHDVRQSURJUDPZLOO v ,QWURGXFHVWXGHQWVWRWKHWUDQVIRUPDWLYHSRZHURIOLYHWKHDWUH3URYLGLQJIUHHVFKRROGD\PDWLQHHVWRDURXQG HOHPHQWDU\VWXGHQWVRIIHULQJWKHPDQHQULFKLQJLQWURGXFWLRQWRWKHDWUHDQGFUHDWLYHH[SUHVVLRQ v ,QFRUSRUDWHWKHDWUHLQWRWKHHGXFDWLRQDOH[SHULHQFH$OLJQLQJWKHSHUIRUPDQFHZLWKFXUULFXOXPREMHFWLYHV IRFXVLQJRQWKHPHVOLNHWKHMR\RIUHDGLQJDQGLPDJLQDWLRQ v 6XSSRUWHGXFDWLRQDOJURZWKWKURXJKDUWLVWLFHQULFKPHQW8VLQJVWRU\WHOOLQJPXVLFDQGWKHDWUHWHFKQLTXHVWR UHLQIRUFHLPSRUWDQWHGXFDWLRQDOFRQFHSWVLQDQHQJDJLQJZD\ 6&5ZLOOPHDVXUHWKHVXFFHVVRIWKHVHRXWFRPHVXVLQJWKHIROORZLQJPHWKRGV v $WWHQGDQFH7UDFNLQJWKHQXPEHURIVWXGHQWVDWWHQGLQJLQFOXGLQJWKRVHIURP7LWOHVFKRROVLQWKH1HZSRUW 0HVD8QLILHG6FKRRO'LVWULFW v 7HDFKHU)HHGEDFNDQG,PSDFW5HSRUWV*DWKHULQJLQVLJKWVIURPWHDFKHUVRQKRZWKHSOD\HQKDQFHGOHVVRQ SODQVDQGWKHHGXFDWLRQDOYDOXHRIWKHH[SHULHQFH v 7LFNHW6DOHVDQG3XEOLF$WWHQGDQFH0RQLWRULQJDWWHQGDQFHDWSDLGSHUIRUPDQFHVWRJDXJHFRPPXQLW\ LQWHUHVWLQIDPLO\IULHQGO\DUWVHYHQWV v 7UDQVSRUWDWLRQ6XEVLG\8WLOL]DWLRQ7UDFNLQJWKHQXPEHURI7LWOHVFKRROVXVLQJWUDQVSRUWDWLRQVXEVLGLHVWR UHPRYHILQDQFLDOEDUULHUVIRUDWWHQGDQFH 139 5 7. Attachments Requested Please do not send material in excess of what is requested; it will not be seen by the City Arts Commission. x A list of Board Members and their affiliations x A recent list of individuals, corporations and foundations that provide organizational support- not to exceed one page. x If you are a 501(c) (3) organization attach a copy of your IRS determination letter (or your fiscal agent’s) indicating tax exempt status. x One brochure and/or one press clipping. Do not send photos, videos, CDs or any other extraneous material. It will not be presented to the City Arts Commission. 8. Please complete this operating budget form for 2024/25 and 2025/26. This is not the project/program budget for which you are applying, but your overall organizational budget. You may annotate at the bottom if there are details critical to the proposal. OPERATING BUDGET 2024/25 Budget (current) 2025/26 Budget (projected) I. Income (cash only) Contributed Earned Total Income II. Expenses Program General and Administrative Marketing and Development Total Expenses III. Operating Surplus/Deficit (Income minus Expenses) IV. Fund Balance at Beginning of Year V. Accumulated Surplus (Deficit) (Add lines III and IV) VI. In-Kind Contributions (attach schedule if greater than 10% of total income) 9. I verify that the information submitted in this application is true and correct to the best of my knowledge. Name ____________________________________ Title ____________________________________ Signature __________________________________________ Date ___________________________ $3,258,000 $8,627,000 $11,885,000 $8,721,000 $1,791,000 $1,373,000 $11,885,000 0 0 0 0 Clare Kiklowicz Director of Development 1/10/2025 _____________________ _______________________________________________ 127(6RXWK&RDVW5HSHUWRU\RSHUDWHVRQDILVFDO\HDUWKDWUXQVIURP6HSWWKURXJK$XJ$V VXFKZHGRQRW\HWKDYHDEXGJHW VHHQRWHEHORZ 140 SOUTH COAST REPERTORY Board of Trustees 2025 Name Professional Affiliation Years on Board Talya Nevo-Hacohen, President Chief Investment Officer and Executive V.P., Sabra Health Care REIT, Tustin 8 Michael R. Hards, VP Advancement Community Leader, Orange 8 Adrian Griggs, VP Finance Executive Vice President, COO, Pacific Life Insurance Company, Newport Beach 6 Timothy J. Kay, VP Development Partner, Snell & Wilmer LLP, Costa Mesa 3 Leona Aronoff-Sadacca, VP Community Relations Community Leader, Irvine 8 Suzanne Appel Managing Director, SCR, Costa Mesa NEW David A. Chase Vice President & Associate General Counsel, Skyworks Solutions, Irvine NEW Sophia Hall Cripe Community Leader, Newport Beach 6 David M. Emmes Founding Artistic Director, SCR, Costa Mesa 52 Susan K. Hori Partner, Manatt, Phelps & Phillips LLC, Costa Mesa NEW David Ivers Artistic Director, SCR, Costa Mesa 6 Lea Kong Community Leader, Foothill Ranch 5 Joe Lobe Senior VP/Regional Private Banking Manager, Wells Fargo Private Bank, Irvine 5 Deepak Nanda Partner, Gibson Dunn & Crutcher, Irvine 6 Tara Netherton Relationship Manager Commercial Banking, US Bank, Newport Beach 6 Giulia Newton Community Leader, Irvine 2 141 SOUTH COAST REPERTORY Board of Trustees 2025 Name Professional Affiliation Years on Board Regina Oswald Designer/Founder & CEO, Regina Oswald LLC, Santa Ana NEW Mark D. Peterson Partner, O’Melveny & Myers LLP, Newport Beach 4 Michael C. Ray Senior Vice President, Micron Technology, Boise ID 6 Susan Shieldkret Community Leader, Los Angeles 6 Tammy Tang Community Leader, Corona Del Mar NEW Ernesto Vasquez Partner & CEO, SVA Architects, Santa Ana 5 Julia Voce Community Leader, Seal Beach 1 Bruce Wagner Community Leader, Orange 6 Nickie Williams Community Leader, Fallbrook 1 Felix Yan Executive Director, JP Morgan Private Bank, Irvine 4 142 ^ŽƵƚŚŽĂƐƚZĞƉĞƌƚŽƌǇŝƐŚŽŶŽƌĞĚĂŶĚŐƌĂƚĞĨƵůƚŽŚĂǀĞŵŽƌĞƚŚĂŶϮ͕ϬϬϬ&ƌŝĞŶĚƐŽĨ^ZǁŚŽƐƵƉƉŽƌƚ ŽƵƌŶŶƵĂů&ƵŶĚ͘ǀĞƌǇǇĞĂƌ͕ƚŚĞ&ƌŝĞŶĚƐĐŽŶƚƌŝďƵƚĞĐƌŝƚŝĐĂůĚŽůůĂƌƐƚŽŚĞůƉƵƐŵĂŬĞƵƉƚŚĞĚŝĨĨĞƌĞŶĐĞ ďĞƚǁĞĞŶƚŚĞŝŶĐŽŵĞǁĞƌĞĐĞŝǀĞĨƌŽŵƚŝĐŬĞƚƌĞǀĞŶƵĞĂŶĚƚŚĞĂĐƚƵĂůĐŽƐƚŽĨƉƌŽĚƵĐŝŶŐƉůĂǇƐ͕ ĐŽŵŵŝƐƐŝŽŶŝŶŐŶĞǁǁŽƌŬƐ͕ďƌŝŶŐŝŶŐƚŚĞĂƚƌĞƚŽƐĐŚŽŽůĐŚŝůĚƌĞŶĂŶĚĂůůƚŚĞŽƚŚĞƌƐĞƌǀŝĐĞƐƚŚĂƚ^Z ƉƌŽǀŝĚĞƐƚŽKƌĂŶŐĞŽƵŶƚǇĂŶĚďĞǇŽŶĚ͘&ƌŝĞŶĚƐ͛ŐŝĨƚƐƌĂŶŐĞĨƌŽŵΨϳϱƚŽŵŽƌĞƚŚĂŶΨϭϬϬ͕ϬϬϬ͘ĂĐŚĂŶĚ ĞǀĞƌǇ&ƌŝĞŶĚŽĨ^ZƉůĂǇƐĂǀĂůƵĂďůĞƌŽůĞŝŶƚŚĞůŝĨĞŽĨƚŚŝƐƚŚĞĂƚƌĞ͘ >ĞĂĚĞƌƐŚŝƉ dŚĞ^ŚƵďĞƌƚ&ŽƵŶĚĂƚŝŽŶ dŚĞ^ĞŐĞƌƐƚƌŽŵ&ŽƵŶĚĂƚŝŽŶ dŚĞEŝĐŚŽůĂƐŶĚŽǁŵĞŶƚ ^ĞŐĞƌƐƚƌŽŵ^ƚĂŐĞWƌŽĚƵĐĞƌƐ :ƵůŝĂŶŶĞΘ'ĞŽƌŐĞƌŐǇƌŽƐͬƌŐǇƌŽƐ&ĂŵŝůǇ &ŽƵŶĚĂƚŝŽŶ ƉƌŝĞŵĚǀŝƐŽƌƐ ZŝĐŚĂƌĚΘ>ŝƐĂĚĞ>ŽƌŝŵŝĞƌ ,ĂƐŬĞůůΘtŚŝƚĞ>>W DŝĐŚĂĞůZĂǇ h͘^͘ĂŶŬ :ƵůŝĂsŽĐĞ DŝĐŬĞǇΘEŝĐŬŝĞtŝůůŝĂŵƐ :ƵůŝĂŶŶĞƌŐǇƌŽƐ^ƚĂŐĞWƌŽĚƵĐĞƌƐ dŝŵŽƚŚǇΘDĂƌŝĂŶŶĞ<ĂǇͬƌŐǇƌŽƐ&ĂŵŝůǇ &ŽƵŶĚĂƚŝŽŶ ,ĂƌŵŽŶΘ>ĞĂ<ŽŶŐ ^ƵƐĂŶ^ŚŝĞůĚŬƌĞƚΘĂǀŝĚƵůů dĂůǇĂEĞǀŽͲ,ĂĐŽŚĞŶΘŝůů^ĐŚĞŶŬĞƌ ^ĂŵƵĞůΘdĂŵŵǇdĂŶŐ EĞǁtŽƌŬ^ƉŽŶƐŽƌƐ ĚŐĞƌƚŽŶ&ŽƵŶĚĂƚŝŽŶ ůŝǌĂďĞƚŚ'ĞŽƌŐĞ&ŽƵŶĚĂƚŝŽŶ EĂƚŝŽŶĂůŶĚŽǁŵĞŶƚĨŽƌƚŚĞƌƚƐ dŚĞ,ĂƌŽůĚΘDŝŵŝ^ƚĞŝŶďĞƌŐŚĂƌŝƚĂďůĞdƌƵƐƚ WĂĐŝĨŝĐWůĂǇǁƌŝŐŚƚƐ&ĞƐƚŝǀĂůWƌŽĚƵĐĞƌƐ <ƌŝƐƚĞŶΘĚƌŝĂŶ'ƌŝŐŐƐ WĞƚĞƌΘ:ŽǇ^ůŽĂŶ dŚĞĂƚƌĞĨŽƌzŽƵŶŐƵĚŝĞŶĐĞƐWƌŽĚƵĐĞƌƐ ƉƌŝĞŵĚǀŝƐŽƌƐ >ĞŽŶĂƌŽŶŽĨĨͲ^ĂĚĂĐĐĂ ĂŶŬŽĨŵĞƌŝĐĂ WůĂǇǁƌŝŐŚƚƐŝƌĐůĞ ŶŽŶǇŵŽƵƐ ^ŽƉŚŝĞΘ>ĂƌƌǇƌŝƉĞ ^ĂŶĚǇ^ĞŐĞƌƐƚƌŽŵĂŶŝĞůƐ ƌ͘ΘDƌƐ͘ZŽďĞƌƚĂǀĞǇ ^ƵƐĂŶ<͘,Žƌŝ DƐ͘^͘>ĞƐůŝĞ:ĞǁĞƚƚΘDƌ͘WĂƚƌŝĐŬWĂĚĚŽŶ :ŽĞůΘ:ƵĚǇ^ůƵƚǌŬǇ ĚƵĐĂƚŝŽŶ^ƉŽŶƐŽƌƐ ŶŽŶǇŵŽƵƐ ĂƉŝƚĂů'ƌŽƵƉ ĂǀŝĚΘ^ƵǌĂŶŶĞŚŽŶĞƚƚĞ DĂƌŐĂƌĞƚ'ĂƚĞƐ ,ĂŶƐΘsĂůĞƌŝĞ/ŵŚŽĨ ^ĐŽƚƚ:ŽƌĚĂŶ dŚĞ<ŽďƌŝŶ&ĂŵŝůǇ WĂĐŝĨŝĐ>ŝĨĞ&ŽƵŶĚĂƚŝŽŶ ĂƌďĂƌĂZŽďĞƌƚƐ :ĂŵĞƐ^ŽŵŵĞƌǀŝůůĞ ZŝĐŚĂƌĚΘůŝǌĂďĞƚŚ^ƚĞĞůĞŶĚŽǁŵĞŶƚ&ƵŶĚ 143 144 145 STUDY GUIDE book by Madhuri Shekar music by Christian Magby lyrics by Christian Albright based on the book by Oliver Jeffers directed by H. Adam Harris146 2 • SOUTH COAST REPERTORY• The Incredible Book Eating Boy T heatre is an art form that depends on both the artists and the audience. A performance is influenced by an audience, just as an audience is influenced by a performance. With this play, the artists and staff of South Coast Repertory have created a special new world for you. Sometimes that world is so exciting that you can barely hold still. But remember: once the play begins, you are connected to all the other people in the audience, as well as to the actors on the stage, because you’re all in the same room. The actors can see you, hear you and feel you, just as you can see, hear and feel them. Your attention, involvement, responses and imagination are a real part of each and every performance. The play can actually be made better because of you! STUDENT TIPS FOR THEATRE TRIPS •Stay with your group at all times and pay attention to your teachers and chaperones. •Take your seat in the theatre before going to the bathroom or getting a drink of water. •Make yourself comfortable while keeping movement to a minimum. •Do not stand up, walk around or put your feet on the seat in front of you. •Absolutely no chewing gum, eating or drinking in the building. •No backpacks, cameras or electronic devices are permitted in the theatre. •Feel free to talk quietly in your seats before the show. •Show your appreciation by clapping for the actors at the end of the play. •After the lights come back up, wait for the ushers to escort your group out of the theatre. THEATRE VOCABULARY • Backstage The space behind the acting area, unseen by the audience. • Blocking The movement designed by the director and performed by the actors. • Box Office A windowed space at the front of the theatre building where tickets are sold. • Choreography The art of creating and arranging dances onstage. • Cue The last words or action of an actor immediately preceding the lines or business of another actor. • Downstage The part of the stage closest to the audience. At one time, stages were raked, or sloped, with the lower (“down”) part closest to the audience, and the higher (“up”) part farther away. • Green Room A room near the stage where actors await entrance cues and receive guests. The room’s name comes from Elizabethan times, when actors waited on a real “green” (or patch of grass). • Matinee A morning or afternoon performance of a play. • Props All the hand-held items and stage furnishings, including furniture, that are physically used by the actors. • Rehearsal Time performers use to practice privately before a performance in front of an audience. • Script The text of the play, including dialogue and stage directions, all written by the playwright. • Upstage The area of the stage farthest away from the audience and nearest to the back wall. Welcome to the Theatre 147 The Incredible Book Eating Boy •SOUTH COAST REPERTORY •3 It’s the first day of third grade, and eight-year- old Henry is feeling queasy. His friends, Jeff and Olivia, think third grade is where it’s at, and Ms. Penny, their new teacher, seems super nice. But for Henry, there’s one big problem—there are no books with pictures in the third grade. Henry hates reading books, especially the ones that have too many words in them! After a frustrating first day at school, Henry feels behind already and doesn’t know what to do. That is until he sees his dog, Rover, swallow a book whole and—miraculously—start to speak in English. Henry is surprised to say the least, but then he decides to give it a try himself. He eats a page of his math textbook, and once he does, he’s suddenly ready for the big test the next day. Henry doesn’t stop at just one book, though. He begins eating all his textbooks, and his new diet puts him at the top of his class. The more books he eats, the more facts he has at his fingertips. The Louisiana Purchase? Henry knows all about that. Newton’s Law of Gravity? Easy to explain. The lifespan of a tortoise? Who doesn’t know that they can live nearly 200 years?! Henry certainly does. He knows everything. He’s the Incredible Book Eating Boy! But after a while, Henry’s eating habits start to cause some problems. Without realizing it, Henry has eaten all the books in the classroom, and now there are none left for the other students to read. Even worse, Henry’s stomach hasn’t been feeling all that well. In fact, it feels awful— awful enough to throw up. And when Henry does, papers go flying everywhere! The doctor writes Henry a prescription: No more eating books. That’s the best way to avoid the jumbly-wumblies, the medical term for what happens when someone eats too many books. Unfortunately, that leaves Henry in his original predicament, with books all around him and no way to absorb the information. There’s only one thing left for Henry to try…and that’s reading. The reading is slow going at first, but soon Henry discov- ers that everyone approaches reading a little bit differently and that everyone likes reading different things. Henry likes comic books, for example, specifically the way they combine text, pictures, and imagination. By the time he reaches the fourth grade, Henry has fallen in love with books. Not eating them but reading them. THE STORY OF THE INCREDIBLE BOOK EATING BOY The Play Did you know The Incredible Book Eating Boy is inspired by an award-winning picture book of the same name, written and illustrated by Oliver Jeffers? It was first published in 2006 and won the 2007 Irish Book Award for Children’s Book of the Year. The musical adaptation is written by Madhuri Shekar, with music and lyrics by Christian Magby and Christian Albright. It received its world premiere production in 2022 at the Alliance Theatre in Atlanta, Georgia. 148 4 • SOUTH COAST REPERTORY• The Incredible Book Eating Boy Classroom Activities BEFORE THE SHOW 1. Have your students read The Incredible Book Eating Boy on their own—or read it aloud as a class. (A link to the full text can be found on the Resources page of this study guide.) After reading, ask your student to: a. Recall the plot’s main events. b. Identify the story’s themes and underlying messages. c. Discuss the book’s artwork. What did author and illustrator Oliver Jeffers use as his canvas? 2. Henry likes eating books (which probably don’t taste very good!). What’s your favorite food? 3. Henry doesn’t like to read at first, but by the end of the book, he loves it. What’s your favorite genre of book and why? 4. Discuss the difference between fiction and drama and explore what it means to “adapt” a book into a musical. 5. Have the students talk about how they think the story of The Incredible Book Eating Boy will be brought to life in South Coast Repertory’s musical stage version. a. What might the scenery on stage look like? b. What about the costumes? c. What do you think the songs will sound like? 6. Discuss the different jobs involved to bring a production like The Incredible Book Eating Boy to life. Have the students research the occupations on the list below and share what they find with the class. a. Actor b. Director c. Playwright d. Composer e. Lyricist f. Music Director g. Choreographer h. Designer i. Stage Manager j. Stage Crew 149 The Incredible Book Eating Boy • SOUTH COAST REPERTORY •5 WORDS! WORDS! WORDS! Listen for the following words during the performance. Amalgamation: (noun) the process or result of joining or bringing together two or more things Dissertation: (noun) a long document about a certain topic Hassle: (verb) to bother or pester Predilection: (noun) a preference or liking for something Gastronomical: (adjective) relating to the art or science of good eating Logically: (adverb) in a way that is clear and makes sense Fortified: (adjective) improved or enhanced through the addition of ingredients, such as vitamins Ironic: (adjective) when something happens in the opposite way to what’s ex- pected Culprit: (noun) someone guilty of a crime or fault Compulsive: (adjective) resulting from an irresistible urge Perspective: (noun) a point of view or a particular attitude towards something Peers: (noun) those belonging to the same group, often based on age or grade in school Can you unscramble these words from the list to the left? (Answers on page 8.) 1. Ticmlasonogar 2. Seper 3. Trsitisaedno 4. Ifftedior 5. Aagnmalotaim 6. Cluprti 7. Vcmlspueoi 8. Ptsiereecpv 9. Elencodiprti 10. Ashsel 11. Liglyloca 12. Nrciio WORD SEARCH Can you spot all the words from the list above? They can be found in all direc- tions—vertically, horizon- tally, and even diagonally. (Some words are listed back- wards, too!) EHRAOHRIWBQAXWQ VJDPMUASHIMYESH IHWKELYSPAFSLOK SBEZYFALLEFOKXN LCINORIGGOLOMOI UONOITATRESSIDX PGGAUMITDMBTSOS MPCIAGIRDOCUWAO OXETCFBXPEYWYTH CAIEIAMYLLITDHI YOLERQLIIUUXNCL NFDXDSDLOPPCJAU MHIDIEJWYKMMMKD GASTRONOMICALYW HHPPERSPECTIVEP 150 6 • SOUTH COAST REPERTORY• The Incredible Book Eating Boy AFTER THE SHOW Discussion about the Theatre When you return from the performance, hold a class discus- sion and ask the students about their experience attending live theatre. 1. What was the first thing you noticed about the theatre? What did the stage look like? 2. Discuss the technical elements of the production— the sets, costumes, lights, and sound. Ask the students what they liked best and why. How did these elements create and define Henry’s world? 3. The original book inspired the overall production design for the play. What similarities or differences did you notice? 4. In musicals, characters express themselves through music and movement. How did the songs help move the story forward? How did the choreography show you the differences between the characters? 5. How is attending a live performance different from attending a movie? How does your experience change when you know the story is being performed live and the actors can see and hear you? Discussion about the Play 1. What was your favorite moment in the play? What was the funniest? What was the most surprising? 2. Ms. Penny encourages Henry to take his time and not rush when reading. Can you think of a time when a teacher helped you overcome a challenge? 3. Henry develops a habit of eating books. Have you ever had to break a bad habit? What steps did you take to stop? 4. Henry discovers he loves knowing things. What is your favorite school subject and why? 5. Transitioning from one grade to the next can be scary but also exciting. Name three things you are looking forward to next school year. ACTIVITIES 1. Pictures in Your Mind: Henry learns that one way to overcome his fear of reading is to use his imagination. Use the space below to draw an image inspired by the musical you just saw. ok Eating Boy red the overall production at similarities or differences express themselves through How did the songs ward? How did the u the differences between performance g a movie? How hange when you performed live nd hear you? hat saw. 151 The Incredible Book Eating Boy •SOUTH COAST REPERTORY •7 2. Cooking & Writing: Henry’s favorite activity is cooking and eating with his family. At home, ask a caregiver to teach you a family recipe step-by-step. As you go through each step, write it down in your own words. Keep it or share it with your friends! 3. How many books did you read in 2024? Picture books count! List them below: LETTERS OF THANKS W rite a letter of thanks to SCR and de- scribe the most memorable aspects of attending a performance of The Incredible Book Eating Boy. South Coast Repertory Attn: TYA PO Box 2197 Costa Mesa, CA 92628-2197 TITLE AUTHOR 1-3 Books: GREAT! 3-6 Books: AMAZING! 6+Books: INCREDIBLE 152 8 • SOUTH COAST REPERTORY • The Incredible Book Eating Boy MORE ABOUT THE INCREDIBLE BOOK EATING BOY PICTURE BOOK The full text of The Incredible Book Eating Boy: https://www.orange.k12.nj.us/cms/lib/NJ01000601/Centricity/Domain/1020/The%20Incredible%20Book%20 Eating%20Boy.pdf MORE ABOUT AUTHOR AND ILLUSTRATOR OLIVER JEFFERS Official website: https://oliverjeffers.com/ MORE ABOUT PLAYWRIGHT MADHURI SHEKAR Official website: https://www.madhurishekar.com/ OTHER STUDY GUIDES Alliance Theatre study guide for The Incredible Book Eating Boy: https://www.alliancetheatre.org/sites/default/files/BEB-studyguide-k-5-v2.pdf WORD SCRAMBLE ANSWER KEY: WORD SCRAMBLE ANSWER KEY: Resources 1. Gastronomical 2. Peers 3. Dissertation 4. Fortified 5. Amalgamation 6. Culprit 7. Compulsive 8. Perspective 9. Predilection 10. Hassle 11. Logically 12. Ironic EHRAOHRIWBQAXWQ VJDPMUASHIMYESH IHWKELYSPAFSLOK SBEZYFALLEFOKXN LCINORIGGOLOMOI UONOITATRESSIDX PGGAUMITDMBTSOS MPCIAGIRDOCUWAO OXETCFBXPEYWYTH CAIEIAMYLLITDHI YOLERQLIIUUXNCL NFDXDSDLOPPCJAU MHIDIEJWYKMMMKD GASTRONOMICALYW HHPPERSPECTIVEP 153 FY 2024-25 Cultural Arts Grants - Subcommittee Recommendations for Grant Funding Organization Requested Recommended Notes The Art Spread $4,600 $- Event October 11, 2025. Booking of artists and instructors will take place March to May. Timeline not compatible. Recommend for events grant. Backhausdance $4,000 $4,000 Unique program that directly benefits our students Balboa Island Improvement Association $3,000 $3,000 Local program that will expand the arts and music on the island for it's resdients and visitors Baroque Music Festival, Corona del Mar $5,500 $4,000 This is a program that is popular with a lot of local residents Emerald Magic Events Inc.$38,000 $2,000 For November concert - Modern Classical and Crossover Music November 15, 2025 Musica Transalpina $5,000 $- Event May 15, 2025. Timeline not compatible for current cycle. Newport Theatre Arts Center $10,000 $5,000 Creative idea to introduce acting in theater to local residents Pacific Chorale $5,000 $3,500 Another popular program with a lot of our local residents Pacific Symphony $5,000 $5,000 Direct benefit to our local students South Coast Repertory $5,000 $3,500 Application mentioned title 1 students a lot which isn't Newport specific. Still will benefit our students though with the shows. Would be nice next year to see how many Newport school kids attend TOTAL FUNDING $85,100 $30,000 "55"$).&/5, 154 &zϮϬϮϰͲϮϱCULTURAL ARTS GRANT APPLICATIONS ORGANIZATION Federal Tax ID Nº ADDRESS1 ADDRESS2 CITY ZIP WEBSITE GEOGRAPHICAL AREA PREVIOUS GRANT YEARS FOUNDED A The Art Spread 85-0576857 3843 S. Bristol Street #270 Santa Ana 92704 theartspread.org Orange County N/A N/A 2020 B Backhausdance 05-0575068 P.O. Box 5890 Orange 92863 www.backhausdance.org Newport Beach, Orange County; Southern CA 2023-24 2020-2023 2003 C Balboa Island Improvement Association (BIIA) 95-6085806 P.O. Box 64 Newport Beach 92662 www.balboaislandnb.org Balboa Island, Newport Beach, Southern California 2023-24 2017-2023 1952 D Baroque Music Festival, Corona del Mar 95-3785942 P.O. Box 838 Corona del Mar 92625 https://bmf-cdm.org Corona del Mar/Newport Beach, other Orange County cities, greater Southern California 2023-24 2017-2019, 2021- 2023 1980 E Emerald Magic Events Inc.99-2307904 1024 Bayside Dr.Ste. 538 Newport Beach 92660 https://www.emeraldmagicevents. org/ Newport Beach N/A N/A 2024 F Musica Transalpina 87-4318307 c/o Bryan Roach, 2520 Kincaid Dr. Apt. 101 Costa Mesa 92626 https://musicatransalpina.org Southern California N/A N/A 2021 G Newport Theatre Arts Center 95-3251950 2501 Cliff Drive Newport Beach 92663 www.ntactickets.com Newport Beach N/A N/A 1979 H Pacific Chorale 95-2585505 3303 Harbor Blvd. Ste. E5 Costa Mesa 92626 www.pacificchorale.org Orange, L.A., Riverside Counties 2023-24 2021-2023 1968 I Pacific Symphony 95-3635496 17620 Fitch Ste. 100 Irvine 92614 www.pacificsymphony.org Orange County 2023-24 2018-2023 1978 J South Coast Repertory 95-6122708 655 Towne Center Drive.P.O. Box 2197Costa Mesa 92628 scr.org Orange County 2023-24 2019-2023 1964 Page 1 ofϮ "55"$).&/5- 155 &zϮϬϮϰͲϮϱ CULTURAL ARTS GRANT APPLICATIONS ORGANIZATION A The Art Spread B Backhausdance C Balboa Island Improvement Association (BIIA) D Baroque Music Festival, Corona del Mar E Emerald Magic Events Inc. F Musica Transalpina G Newport Theatre Arts Center H Pacific Chorale I Pacific Symphony J South Coast Repertory STAFF VOLUNTEERS PROGRAM REQUEST NB PEOPLE SERVED GRANTED GRANTED GRANTED GRANTED GRANTED GRANTED GRANTED 2023-24 2022-23 2021-22 2020-2021 2019-2020 2018-2019 2017-18 10 25 Beyond Aesthetics is a community event bringing art, yoga, and community partnership together. Local and international artwork will be displayed for sale, with three interactive workships led by artists active in the local community: a Mixed Media workshop, a Functional Art workshop, and a Yoga and Creativity Workshop. Small businesses will provide food to highlight Newport Beach's culinary culture. $4,600 150 0000000 15 20 Dance Expressions: Creativity and Choreography is an in-depth dance education partnership with three schools in Newport-Mesa: Corona del Mar Middle/High School, Back BayHigh School, and Newport Harbor High School serving over 150 Nepwort Beach teens.Students will be trained in various forms of dance by Backhausdance instructors and develop new choreography for the Fall 2025 Student Showcase at CDM Highschool. $4,000 1,300 4,000.00$ 3,000$ 4,000$ 4,000$ 0 0 0 0 155 Funds will be used for a concert series taking place at St. John Vianney Chapel and Carol Beek Center with a minimum of 5 classical concerts and 5 concerts in the park. Estimated attendance is 172 for concerts at the Chapel and 150 for concerts at the Center. Classical concerts are $20 a person, though all summer concerts are free. Ticket monies go towards compensating musicians, rentals, and promotional materials. $3,000 2150+ 3,000.00$ 3,000$ 3,000$ 0 2,500$ 2,000$ 1,000 1 PT 20 A new program, The Finale, will focus on evocative vocal works by Vivialdi and Antonio Lotti. Funds will be used for middle school, high school, and college students from Newport Beach to attend the dress rehearsal and opening concert dress rehearsal in June. Students will learn about the detailed rehearsal process and can ask questions, explore instruments, and attend the formal concert the next day. $5,500 600 4,500.00$ 5,000$ 5,000$ 4,000$ 4,000$ 4,000$ 0 2 7 The Best Romantic Pieces of the Centuries - Two classical musical concerts at the OASIS Senior Center, one in May 2025 and October 2025. The first concert will feature classical music by Chopin, Handel, Vivaldi, and more. The second concert will showcase talented music groups from Newport Beach performing classical crossovers that fuse classical music with popular music styles. $38,000 500 0 0 00000 1 15 Funds will go towards a performance of rare Baroque music at St. Mark's Presbyterian Church in Newport Beach featuring Marian hymns by female composters of the 17th century. Performance will include professional singers from Southern California, multi- award-winning soloist Anna Schubert, guitar instrumenalist of the Boston Baroque music festival, Stephen Stubbs, and internationally renowned harpist Maxine Islander. $5,000 150+0 0 00000 3 50 Funds will go towards a new program conducting a theatre seminar for the local community with multiple sessions throughout the day for children and adults. The event will provide an immersive educational experience for all ages to enlighten the community about the many benefits and value of the arts in Newport Beach. Planned for late spring or early summer. $10,000 50-100 0 0 00000 8 Full time, 50 Part time 150 Funds will be used for three performances at Our Lady Queen of Angels Catholic Church in March and December 2025. The March concert will feature Handel's musical depiction of Exodus: Israel in Egupt. The December concert will feature Carols by Candleight for a traditional and contemporary holiday program in a peaceful candlelit setting. $5,000 1,800 5,000.00$ 4,500$ 5,000$ 0000 50 2,436 Funds will provide The Class Act Music Education program in two Newport Beach Schools in 2025: Andersen and Newport Coast Elementary. Running from September to June, placing Pacific Symphony union musicians into schools where students recieve music learning from teaching artists, on-site school performances and a trip to the concert hall for a full Pacific Symphony performance. $5,000 794 3,500.00$ 5,000$ 5,000$ 5,000$ 5,000$ 5,000$ 0 97 200 The Theatre for Young Audiences (TYA) progam, running since 2003, introduces young audiences to live theatre. The production of The Incredible Book Eating Boy, a family musical, will run 16 free school-day matinee shows for local students. Bus transportation subsidies will be provided, and TYA provides study guides and program booklets to help integrate themes from the play into classroom learning. $5,000 1700 per performance 5,000.00$ 4,500$ 3,000$ 8,750$ 5,000$ 0 0 $85,100 Page ϮŽĨϮ156 I-10 1 CULTURE AND ARTS GRANTS The City Council hereby recognizes the importance of promoting culture and the arts within Newport Beach. Pursuant to City Council Policy A-12, the City budget specifically allows the City Council to direct revenue towards worthy projects and programs which the City Council deems beneficial to the quality of life for Newport Beach’s residents. A number of individuals and groups have been organized with the express purpose of developing and promoting culture, theatre and the arts. In regard to the City's role in financially sponsoring art and cultural events, up to $55,000 shall be expended from the General Fund for culture and arts grants each fiscal year. The City Arts Commission shall review all programs and requests for support from arts groups. The Commission shall forward its recommendations for funding to the City Council for final approval. For the purpose of this policy, arts groups shall be defined as those involved in visual, musical, theatre, dance, crafts, performing and literary activities. The following priorities shall be considered by the Commission. The order of preference for granting support shall be as follows: A. Local arts groups located within the City and offering programs to City residents; B. Regional arts groups located in Orange County and offering programs to City residents; and C. Arts groups located in California and performing or offering programs to City residents. Groups not offering programs or services to local residents shall not be eligible for support from the City. History Adopted F-20 –5-11-1981 (“Reserve Fund for Culture and Arts”) Amended F-22 –6-22-1981 Adopted I-20 –1-24-1983 (“Co-Sponsorship for Cultural Events and Arts Groups”) Amended F-20 –11-14-1983 Amended F-20 –1-23-1984 Amended F-20 –3-28-1988 Amended F-20 –10-28-1991 Created I-12 –1-24-1994 (incorporating I-20 and F-20, and renaming “Financial Support for Culture and Arts”) Amended I-12 –5-8-2001 Amended I-12 - 4-8-2003 (changed to I-10) Amended I-10 –8-8-2017 Amended I-10 –11-12-2024 $77$&H0(170 157 CITY OF NEWPORT BEACH CITY ARTS COMMISSION STAFF REPORT February 13, 2025 Agenda Item No. 6 RECOMMENDATION: Staff recommends the City Arts Commission review and approve the Music and Live Entertainment Ad Hoc Subcommittee’s recommendations of two bands, a Pacific Symphony performance, and two alternate bands for the summer concert series on the Civic Center Green, as well as review and approve a band and an alternate for the fall concert at Marina Park. FUNDING REQUIREMENTS: Band performance fees, sound engineering, children’s activities, and other associated costs for the 2025 concerts is estimated at approximately $35,000. These funds will be expensed from the Cultural Arts Division FY 2025-26 programming budget. In addition, the performance fee for Pacific Symphony is $30,000. The City received a $30,000 donation to support public amenities from a coastal development application. This donation will cover the cost of the Pacific Symphony performance fee. The Music and Live Entertainment Ad Hoc Subcommittee is also recommending the addition of a stage to elevate the bands and a metal truss with a banner for promotional purposes during the performances on the Civic Center Green. Staff have requested quotes from the sound engineer vendor and are awaiting the response. DISCUSSION: The City Arts Commission presents three live concerts on the Civic Center Green during the summer months and one live concert at Marina Park in the fall. The Music and Live Entertainment Ad Hoc Subcommittee recommends performers to the City Arts Commission for approval. Staff negotiates a fee with the performers, coordinates the use of the Civic Center Green and Marina Park, publicizes the events, and hires a sound engineering contractor for the performances. The performers submitted for approval for the Civic Center Green for the summer of 2025 are: • Tijuana Dogs (Rock/Dance/Party) • Pacific Symphony (Orchestra) • Cassie B (Singer/Songwriter) TO: CITY ARTS COMMISSION FROM: Library Services Department Melissa Hartson, Library Services Director (949) 717-3801, mhartson@newportbeachca.gov PREPARED BY: Melissa Hartson, Library Services Director TITLE: Summer Concerts on the Civic Center Green and Fall Concert at Marina Park CITY OF NEWPORT BEACH CITY ARTS COMMISSION STAFF REPORT 2 of 2 Alternates in order of selection are: • Red Skies (80’s Dance/Electric) • The Fabba Show (ABBA Cover band) The performer submitted for approval for the Marina Park concert is: • The 805 Social Club (Pop/Classic Rock/Disco/Punk) The alternate for Marina Park is: • Empty Pockets (Blues/Rock) Each concert will feature food trucks and children’s activities. NOTICING: This agenda item has been noticed according to the Brown Act (72 hours in advance of the meeting at which the City Arts Commission considers the item). ATTACHMENT A: 2025 Concerts on the Green – Band Recommendations 2025 Concerts on the Civic Green and Marina Park Concert SUBCOMMITTEE RECOMMENDATIONS Venue Band Name Genre Website Video Link Civic Center Tijuana Dogs Rock/Dance/Party Website Link Video Link Civic Center Pacific Symphony Orchestra Website Link Video Link Civic Center Cassie B Singer/Songwriter Website Link Video Link Marina Park The 805 Social Club Pop/Classic Rock/Disco/Punk Website Link Video Link ALTERNATE PERFORMERS Venue Band Name Genre Website Video Link Civic Center Red Skies 80’s Dance/Electric Website Link Video Link Civic Center The Fabba Show ABBA cover band Website Link Video Link Marina Park Empty Pockets Blues/Rock Website Link Video Link ATTACHMENT A