The URL can be used to link to this page

Home My WebLink AboutCity Arts Commission 02-12-2026 Regular Monthly Meeting AgendaCITY OF NEWPORT BEACH CITY ARTS COMMISSION AGENDA Newport Beach Council Chambers 100 Civic Center Drive, Newport Beach CA 92660 Thursday, February 12, 2026 - 5:00 PM City Arts Commission Members: Heather Ignatin, Chair Vanessa Moore, Vice Chair David Anastos, Commissioner John Blom, Commissioner Cory Glass, Commissioner Tiare Meegan, Commissioner Laurel Tippett, Commissioner Staff Members: Melissa Hartson, Library Services Director Rebecca Lightfoot, Library Services Manager Camille Escareal-Garcia, Cultural Arts Assistant The City Arts Commission meeting is subject to the Ralph M. Brown Act. Among other things, the Brown Act requires that the City Arts Commission agenda be posted at least seventy-two (72) hours in advance of each regular meeting and that the public be allowed to comment on agenda items before the Commission and items not on the agenda but are within the subject matter jurisdiction of the City Arts Commission. The Chair may limit public comments to a reasonable amount of time, generally three (3) minutes per person. The public can submit questions and comments in writing for the City Arts Commission to consider. Please send them by email to the Library Services Department at ArtsCommission@newportbeachca.gov by Wednesday, February 11, 2026 at 5:00 p.m. to give the City Arts Commissioners time to consider your comments. All emails will be made part of the record. The City of Newport Beach’s goal is to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, you will need special assistance beyond what is normally provided, we will attempt to accommodate you in every reasonable manner. Please contact Rebecca Lightfoot, Library Services Manager, at least forty-eight (48) hours prior to the meeting to inform us of your particular needs and to determine if accommodation is feasible at (949) 717-3801 or rlightfoot@newportbeachca.gov. NOTICE REGARDING PRESENTATIONS REQUIRING USE OF CITY EQUIPMENT Any presentation requiring the use of the City of Newport Beach’s equipment must be submitted to the Library Services Department 24 hours prior to the scheduled meeting. I.CALL MEETING TO ORDER II.ROLL CALL III.PLEDGE OF ALLEGIANCE IV.PRESENTATION(S) 2025 Student Art Exhibition Award Ceremony1. The City Arts Commission will present the awards for the 2025 Student Art Exhibition winners. February 12, 2026 Page 2 City Arts Commission Meeting V.NOTICE TO THE PUBLIC The City provides a yellow sign-in card to assist in the preparation of the minutes. The completion of the card is not required in order to address the City Arts Commission. If the optional sign-in card has been completed, it should be placed in the tray provided. The City Arts Commission of Newport Beach welcomes and encourages community participation. Public comments are generally limited to three (3) minutes per person to allow everyone to speak. Written comments are encouraged as well. The City Arts Commission has the discretion to extend or shorten the time limit on agenda or non-agenda items. As a courtesy, please turn cell phones off or set them in the silent mode VI.CONSENT CALENDAR All matters listed under CONSENT CALENDAR are considered to be routine and will all be enacted by one motion in the form listed below. City Arts Commissioners have received detailed staff reports on each of the items recommending an action. There will be no separate discussion of these items prior to the time the City Arts Commission votes on the motion unless members of the City Arts Commission request specific items to be discussed and/or removed from the Consent Calendar for separate action. Members of the public who wish to discuss a Consent Calendar item should come forward to the lectern upon invitation by the Chair. A.Consent Calendar Items Minutes of the January 8, 2026, City Arts Commission Meeting2. 01-08-2026 Meeting Minutes Financial Report3. Review of financial information. Financial Report VII.CURRENT BUSINESS A.Items for Review and Possible Action General Plan Update: Final GPUSC/GPAC Draft Arts and Culture and Historical Resources Elements 4. Staff recommends that the City Arts Commission review the Final GPUSC/GPAC Draft Arts and Culture Element and Historical Resources Element, which have been revised to incorporate the Commission’s input from November 2025. The Commission should conduct a vote to consider recommending the City Council adopt them as part of the comprehensive General Plan Update later this year. General Plan Staff Report Attachment A Attachment B Attachment C February 12, 2026 Page 3 City Arts Commission Meeting Fiscal Year 2025-26 Cultural Arts Grants5. Staff recommend the City Arts Commission review grant applications and approve the recipients for recommendation to City Council for the FY 2025-26 Cultural Arts Grants in accordance with City Council Policy I-10 - Culture and Arts Grants. Cultural Arts Grants Staff Report Attachment A Attachment B Attachment C Attachment D Attachment E Attachment F Attachment G Attachment H Attachment I Attachment J Cultural Arts Activities6. Monthly review of cultural arts activities from the Library Administrative Office for upcoming Library and City arts events and services. Cultural Arts Activities Staff Report B.Monthly Reports Art in Public Places Ad Hoc Subcommittee7. Commissioner Anastos, Commissioner Meegan Art Week Ad Hoc Subcommittee8. Chair Ignatin, Vice Chair Moore, Commissioner Tippett Music and Live Entertainment Ad Hoc Subcommittee9. Chair Ignatin, Vice Chair Moore, Commissioner Glass Cultural Arts Grants Ad Hoc Subcommittee10. Vice Chair Moore, Commissioner Meegan Newport Beach Art Exhibition Ad Hoc Subcommittee11. Chair Ignatin, Vice Chair Moore February 12, 2026 Page 4 City Arts Commission Meeting Public Relations and Marketing Ad Hoc Subcommittee12. Chair Ignatin, Vice Chair Moore, Commissioner Glass Memo Sculpture Exhibition Ad Hoc Subcommittee13. Chair Ignatin, Commissioner Blom Student Art Exhibition Ad Hoc Subcommittee14. Commissioner Anastos, Commissioner Meegan, Commissioner Tippett General Plan Update Ad Hoc Subcommittee15. Chair Ignatin, Vice Chair Moore, Commissioner Blom Newport Beach Arts Foundation Liaison16. Vice Chair Moore Historical Resources Liaison17. Commissioner Blom VIII.CITY ARTS COMMISSION ANNOUNCEMENTS OR MATTERS WHICH MEMBERS WOULD LIKE PLACED ON A FUTURE AGENDA FOR DISCUSSION, ACTION OR REPORT (NON-DISCUSSION ITEM). IX.PUBLIC COMMENTS ON NON-AGENDA ITEMS Public comments are invited on non-agenda items generally considered to be within the subject matter jurisdiction of the City Arts Commission. Speakers must limit comments to three (3) minutes. Before speaking, we invite, but do not require, you to state your name for the record. The City Arts Commission has the discretion to extend or shorten the speakers’ time limit on agenda or non-agenda items, provided the time limit adjustment is applied equally to all speakers. As a courtesy, please turn cell phones off or set them in the silent mode. X.ADJOURNMENT CITY OF NEWPORT BEACH CITY ARTS COMMISSION MINUTES Newport Beach Civic Center – Council Chambers 100 Civic Center Drive, Newport Beach 92660 Thursday, January 8, 2026 – 5:00 PM City Arts Commission Members: Heather Ignatin, Chair Vanessa Moore, Vice Chair David Anastos, Commissioner John Blom, Commissioner Cory Glass, Commissioner Tiare Meegan, Commissioner Laurel Tippett, Commissioner Staff Members: Melissa Hartson, Library Services Director Rebecca Lightfoot, Library Services Manager Camille Escareal-Garcia, Cultural Arts Assistant DRAFT I. CALL MEETING TO ORDER Chair Heather Ignatin called the City Arts Commission Regular Meeting to order at 5:02 P.M. II. ROLL CALL Commissioners Present: Chair Heather Ignatin Vice Chair Vanessa Moore Commissioner David Anastos Commissioner Laurel Tippett Commissioners Absent: Commissioner John Blom (excused) Commissioner Cory Glass (excused) Commissioner Tiare Meegan (excused) Staff Present: Melissa Hartson, Library Services Director Rebecca Lightfoot, Library Services Manager Camille Escareal-Garcia, Cultural Arts Assistant III. PLEDGE OF ALLEGIANCE Chair Ignatin led the Pledge of Allegiance. IV. NOTICE TO THE PUBLIC The Notice to the Public was read, explaining the public comment procedures and requesting that cell phones be turned off or set to silent mode. 5 City Arts Commission Meeting January 8, 2026 Page 2 V. CONSENT CALENDAR A. Consent Calendar Items 1. Minutes of the December , 2025, City Arts Commission Meeting 2. Financial Report Review of financial information. Chair Ignatin asked for commissioner comments on the Consent Calendar items, which included the minutes from the December 11, 2025, meeting and the financial report. Seeing no comments from commissioners or the public, the Chair called for a vote. Motion by Chair Ignatin, seconded by Commissioner Anastos, to approve the consent calendar. Motion carried unanimously (4-0-0-3). VI. CURRENT BUSINESS A. Items for Review and Possible Action 3. Spin Art at the Mayor’s Egg Race Staff recommend the City Arts Commission review and approve the Music and Live Entertainment Ad Hoc Subcommittee’s recommendation to provide a Spin Art Activity at the 11th Annual Mayor’s Egg Race. Manager Rebecca Lightfoot presented a recommendation from the Music and Live Entertainment Ad Hoc Subcommittee to provide a spin art activity at the 11th Annual Mayor's Egg Race scheduled for March 28, 2026. The activity would cost approximately $1,250 for 200 spin arts. This anticipated cost would include the vendor bringing all supplies, running the spin art stations, handling artwork displays, and cleaning up after the event. Vice Chair Moore added that the vendor would also provide stencils of bunnies or eggs for the children to cut out after their artwork dried, thematically connecting the art activity to the event. Commissioner Anastos inquired about cleanup responsibilities, and Manager Lightfoot confirmed the vendor would handle cleanup specific to the spin art activity, while Parks and Recreation would manage general event cleanup. After no public comments, the Chair called for a vote. Motion by Chair Ignatin, seconded by Vice Chair Moore, to approve Spin Art at the Mayor’s Egg Race. Motion carried unanimously (4-0-0-3). 4. 2025 Student Art Exhibition Winners Staff recommend the City Arts Commission approve the winning submissions of the 2025 Student Art Exhibition Ad Hoc Subcommittee. 6 City Arts Commission Meeting January 8, 2026 Page 3 Manager Lightfoot presented the Student Art Exhibition Ad Hoc Subcommittee's recommendations for the 2025 exhibition winners across three categories: Pre-K through 3rd grade, 4th through 7th grade, and 8th through 12th grade. Each category would have first, second, and third place winners, with prizes of $100, $50, and $25 Amazon gift cards respectively, totaling $525 from the programming budget. The winning artwork is on display in the Central Library lobby until February 23rd, and ribbons would be placed on the winning pieces. Cultural Arts Assistant Escareal-Garcia clarified that winners would be invited to a presentation ceremony at the beginning of the February 12th City Arts Commission meeting. Commissioners Anastos and Tippett, who served on the Student Art Exhibition Subcommittee, noted the quality of submissions, with Commissioner Anastos describing the selection process as "rigorous" and noting there were some "budding artists" among the submissions. With no public comments, the item was put to a vote. Motion by Commissioner Anastos, seconded by Commissioner Tippett, to approve the 2025 Student Art Exhibition winners. Motion carried unanimously (4-0-0-3). 5. Summer Concerts on the Civic Green and Fall Concert at Marina Park Staff recommend the City Arts Commission review and approve the Music and Live Entertainment Ad Hoc Subcommittee’s recommendations of two bands, a Pacific Symphony performance, and one alternate band for the summer concert series on the Civic Center Green, as well as review and approve a band and an alternate for the Fall concert at Marina Park. Manager Lightfoot presented the Music and Live Entertainment Ad Hoc Subcommittee's recommendations for performers at the summer concerts on the Civic Center Green and the fall concert at Marina Park. The recommendation included two bands (Flashback Heart Attack and Redneck Rodeo), a Pacific Symphony performance, and Yachty by Nature as an alternate for the summer series. For the fall concert at Marina Park, Diego's Garage was recommended with Sega Genocide as the alternate. The total budget for band performances, sound engineering, children's activities, and other costs was approximately $36,750, reflecting a slight increase from the previous year due to one band's fee being $5,000 instead of the usual $3,250. Additionally, the Pacific Symphony performance fee was $45,000, with a funding request submitted to the Newport Beach Arts Foundation to help with this expense. The Subcommittee also recommended adding a stage with a metal truss and promotional banner, similar to the previous year. Food trucks and children's activities would be available at each concert. Vice Chair Moore noted the Arts Foundation would be meeting the following week to consider the funding request, with another meeting before the Commission's February meeting. 7 City Arts Commission Meeting January 8, 2026 Page 4 Commissioner Anastos inquired about sponsorship opportunities, and Vice Chair Moore indicated this would be discussed in the monthly report from the Public Relations and Marketing Subcommittee. During public comment, Jim Mosher noted the staff report lacked information about how many applications were reviewed by the Ad Hoc Committee. He also mentioned that in previous years, the entire Commission had reviewed applications and made collective choices, noting that tastes differ among commissioners. Vice Chair Moore confirmed that last year's process was the same as this year's, with the Ad Hoc making the selections rather than the full Commission. Motion by Vice Chair Moore, seconded by Commissioner Tippet, to approve the Music and Live Entertainment’s recommendations for the following performances: 2026 Summer Concerts on the Civic Green • Flashback Heart Attack • Redneck Rodeo • Pacific Symphony • Yachty by Nature (alternate) 2026 Fall Concert at Marina Park • Diego’s Garage • Sega Genocide (alternate) Motion carried unanimously (4-0-0-3). 6. Cultural Arts Activities Monthly review of cultural arts activities from the Library Administrative Office for upcoming Library and City arts events and services Manager Lightfoot reported that the Central Library Gallery Wall currently featured silver gelatin contact print artwork by Hugo Zhang, with digital photography scheduled to be installed next month. She also noted that the City Arts Commission had distributed 100 custom-made commemorative holiday ornaments at the Marina Park Community Center Family Fun Night on December 19th. Manager Lightfoot informed the Commission that the Sculpture Exhibition Phase X recommendations would be on the City Council agenda for January 13th, 2026, at 4:00 PM, inviting commissioners to attend if interested. B. Monthly Reports The Chair noted that these reports from the Commission's ad hoc subcommittees were informational only, and public comments would be taken after all oral reports were finished. 7. Art in Public Places Ad Hoc Subcommittee 8 City Arts Commission Meeting January 8, 2026 Page 5 Commissioner Anastos, Commissioner Meegan Commissioner Anastos reported that they met and are in the process of touring all possible public places for art and will be looking at the City’s art inventory currently being kept in storage soon. 8. Art Week Ad Hoc Subcommittee Chair Ignatin, Vice Chair Moore, Commissioner Tippett Vice Chair Moore reported they did not meet this month, but applications were starting to come in. 9. Music and Live Entertainment Ad Hoc Subcommittee Chair Ignatin, Vice Chair Moore The Chair appointed Commissioner Cory Glass to this Ad Hoc Subcommittee. 10. Cultural Arts Grants Ad Hoc Subcommittee Vice Chair Moore, Commissioner Meegan Vice Chair Moore reported they did not meet. 11. Newport Beach Art Exhibition Ad Hoc Subcommittee Chair Ignatin, Vice Chair Moore The Chair reported that they did not meet. 12. Public Relations and Marketing Ad Hoc Subcommittee Chair Ignatin, Vice Chair Moore Vice Chair Moore reported they met and were discussing with staff and the City’s Attorney Office the potential sponsorship opportunities through the Foundation for events the Commission holds. Commissioner Anastos asked who was handling the discussion on the city's side, and Rebecca Lightfoot confirmed it was the city attorney. The Chair appointed Commissioner Corey Glass to this Ad Hoc subcommittee. 13. Sculpture Exhibition Ad Hoc Subcommittee Chair Ignatin, Commissioner Blom Chair Ignatin reported that there was no meeting. 9 City Arts Commission Meeting January 8, 2026 Page 6 14.Student Art Exhibition Ad Hoc Subcommittee Commissioner Anastos, Commissioner Meegan, Commissioner Tippett Commissioner Tippett reported that there was no additional report beyond the earlier agenda item. 15.Newport Beach Arts Foundation Liaison Vice Chair Moore Vice Chair Moore reported that the Foundation’s meeting would be the following week. 16.Historical Resources Liaison Commissioner Blom No report was provided as Commissioner Blom was absent. 17.General Plan Update Ad Hoc Subcommittee Ignatin, Moore, Blom No report was provided. VII.CITY ARTS COMMISSION ANNOUNCEMENTS OR MATTERS WHICH MEMBERSWOULD LIKE PLACED ON A FUTURE AGENDA FOR DISCUSSION, ACTION, ORREPORT (NON-DISCUSSION ITEM) No items were suggested for a future agenda. VIII.PUBLIC COMMENTS ON NON-AGENDA ITEMS There were no public comments on non-agenda items. IX.ADJOURNMENT – 5:21 P.M. Chair Ignatin adjourned the meeting. 10 As of February 1, 2026 ACCT NAME BUDGET DATE VENDOR DEPOSITS EXPENSES AVAILABLE NOTES Programming 60,500.00 07/04 Bene-Marc 2,861.25 57,638.75 Concerts on the Green Insurance 07/18 DJE Sound & Lighting 6,113.19 51,525.56 07-27-25 COTG Sound (Cassie B) 07/18 CB Music Productions 3,250.00 48,275.56 07-27-25 COTG Band (Cassie B) 07/22 Funds Transferred In 30,000.00 78,275.56 Funds transferred for Pacific Symphony Concert 07/25 ARTovator (Tracy Kiggen)968.00 77,307.56 07-27-25 COTG Children's Activities (Cassie B) 07/31 Gotprint.com 102.16 77,205.40 COTG Banners 07/31 Gotprint.com 80.30 77,125.10 COTG Library Entrance Banner 08/01 Crisp Imaging 1,266.89 75,858.21 Concerts on the Green Backdrop 08/07 ARTovator (Tracy Kiggen)625.00 75,233.21 08-17-2025 COTG Children's Activities 08/08 Pacific Symphony 30,000.00 45,233.21 08-17-2025 COTG Band (Pacific Symphony) 08/22 Crisp Imaging 1,236.50 43,996.71 Pacific Symphony Concert Banners 08/22 Amazon.com 129.29 43,867.42 08-17-2025 COTG Step & Repeat 08/22 LAZ Parking 1,191.65 42,675.77 08-17-2025 COTG Parking/Traffic Control 08/22 ARTovator (Tracy Kiggen)625.00 42,050.77 09-14-2025 COTG Children's Activities 08/29 Scott Smeltzer 1,266.42 40,784.35 08-17-2025 COTG Photographer 08/29 ATEI Company 3,250.00 37,534.35 09-14-2025 COTG Band (Tijuana Dogs) 08/29 Capture Imaging 902.00 36,632.35 08-17-2025 COTG Photographer 08/31 Gotprint.com 489.74 36,142.61 Pacific Symphony Concert Signage 08/31 Smart and Final 63.43 36,079.18 COTG supplies 09/05 Scott Smeltzer 700.00 35,379.18 09-14-2025 COTG Photographer 09/12 DJE Sound & Lighting 6,113.19 29,265.99 09-14-2025 COTG Sound (Tijuana Dogs) 09/19 805 Social Club (Erik Tarkiainen)3,250.00 26,015.99 10-12-2025 Marina Park Concert (805 Social Club) 09/26 Capture Imaging Inc.550.00 25,465.99 10-12-2025 Marina Park Photographer 09/26 ARTovator (Tracy Kiggen)625.00 24,840.99 10-12-2025 Marina Park Children's Activities 09/30 Gotprint.com 52.51 24,788.48 10-12-2025 Marina Park Banner 09/30 Tanaka Farms University 1,564.24 23,224.24 Spooktacular pumpkins for painting 10/07 Funds Transferred Out 1,500.00 21,724.24 Funds transferred to Advertising & Public Relations 10/10 Amazon.com 155.32 21,568.92 Spooktacular supplies 10/10 Amazon.com 210.36 21,358.56 Student Art Exhibition supplies 10/31 Kleenway Services 134.70 21,223.86 Day porters for COTG 07-27-25 concert 10/31 Kleenway Services 134.70 21,089.16 Day porters for COTG 08-11-25 concert 10/31 Kleenway Services 134.70 20,954.46 Day porters for COTG 09-14-25 concert 10/31 Ralphs 10.17 20,944.29 Spooktacular supplies 10/31 Costco 41.98 20,902.31 Spooktacular supplies 11/06 Printworks ETC. Inc.935.69 19,966.62 Holiday ornaments 11/06 Amazon.com 80.29 19,886.33 Art Exhibition supplies 11/06 Amazon.com 81.36 19,804.97 Student Art Exhibition supplies 11/26 Kleenway Services 134.70 19,670.27 Day porters for Marina Park 10-12-25 concert 12/18 Creative West (CallforEntry.org)120.00 19,550.27 Yearly Subscription Renewal TOTAL 90,500.00 70,949.73 19,550.27 City Grants 30,000.00 TOTAL 30,000.00 0.00 30,000.00 Professional Services 23,000.00 08/05 Funds Transferred Out 9,370.00 13,630.00 Funds transferred to Maintenance & Repair Budget 08/28 Svartifoss Corp 175.00 13,455.00 Joe Cladis Art Installation 08/29 Transcription Services 150.00 13,305.00 07-10-2025 CAC Meeting Minutes Transcription 10/10 Svartifoss Corp 1,707.00 11,598.00 Central Library Gallery Rails installation 10/31 Svartifoss Corp 350.00 11,248.00 Susan Neas Art Installation 11/07 Transcription Services 262.50 10,985.50 08-13-2025 CAC Meeting Minutes Transcription 11/07 Transcription Services 150.00 10,835.50 09-11-2025 CAC Meeting Minutes Transcription 12/18 Svartifoss Corp 325.00 10,510.50 Hugo Zhang Art Installation 01/15 Svartifoss Corp 400.00 10,110.50 Student Art Exhibition Installation TOTAL 23,000.00 12,889.50 10,110.50 Sculpture Exhibition 214,000.00 08/15 ArtsOrange County 3,125.00 210,875.00 Phase X Project Management 1 of 12 08/29 ArtsOrange County 3,125.00 207,750.00 Phase X Project Management 2 of 12 10/02 ArtsOrange County 3,125.00 204,625.00 Phase X Project Management 3 of 12 10/31 ArtsOrange County 3,125.00 201,500.00 Phase X Project Management 4 of 12 12/11 ArtsOrange County 3,125.00 198,375.00 Phase X Project Management 5 of 12 01/15 ArtsOrange County 3,125.00 195,250.00 Phase X Project Management 6 of 12 TOTAL 214,000.00 18,750.00 195,250.00 Cultural Arts Division FY 2025-26 1 of 2 11 As of February 1, 2026 ACCT NAME BUDGET DATE VENDOR DEPOSITS EXPENSES AVAILABLE NOTES Cultural Arts Division FY 2025-26 Advertising 1,340.00 07/31 Facebook.com 2.67 1,337.33 08-17-25 COTG Pacific Symphony Ad 07/31 Facebook.com 12.00 1,325.33 08-17-25 COTG Pacific Symphony Ad 07/31 Facebook.com 4.10 1,321.23 08-17-25 COTG Pacific Symphony Ad 07/31 Gotprint 105.56 1,215.67 Pacific Symphony Rack Cards 08/31 Facebook.com 70.00 1,145.67 08-17-25 COTG Pacific Symphony Ad 08/31 Facebook.com 62.33 1,083.34 08-17-25 COTG Pacific Symphony Ad 08/31 2S P LLC (Stu News)450.00 633.34 08-17-25 COTG Pacific Symphony Ad 08/31 2S P LLC (Stu News)450.00 183.34 08-17-25 COTG Pacific Symphony Ad 08/31 LA Times Media Group 410.20 (226.86)08-17-25 COTG Pacific Symphony Ad 08/31 Instagram Ad 15.76 (242.62)08-17-25 COTG Pacific Symphony Ad 09/30 Instagram Ad 32.18 (274.80)09-14-25 COTG Tijuana Dogs Ad 09/30 Instagram Ad 27.36 (302.16)10-12-25 Marina Park Concert Ad 09/30 Facebook.com 11.71 (313.87)Sculpture Exhibition Public Poll Ad 10/07 Funds Transferred 1,500.00 0.00 1,186.13 Funds Transferred from Programming 01/23 Instagram Ad 55.58 1,130.55 Student Art Exhibition/Spooktacular Instagram ads 01/23 Instagram Ad 83.00 1,047.55 Halloween Spooktacular Instagram ads 11/17 Instagram Ad 37.33 1,010.22 Student Art Exhibition Instagram ads 12/31 Instagram Ad 16.60 993.62 Art Week Application Instagram Ads TOTAL 2,840.00 1,846.38 993.62 Maintenance & Repair 4,248.00 08/05 Funds Transfer In 9,370.00 (9,370.00)13,618.00 Funds transferred from Professional Services 09/05 Crown Building Services 825.00 12,793.00 Sphere 112 Cleaning 12/04 Crown Building Services 825.00 11,968.00 Sphere 112 Cleaning TOTAL 13,618.00 1,650.00 11,968.00 Publication and Dues 1,000.00 01/15 ASCAP 1,100.00 (100.00)Music Licensing Fee TOTAL 1,000.00 1,100.00 (100.00) ACCT NAME BUDGET DATE VENDOR REVENUES REVENUES AVAILABLE NOTES Special Events (NBAE)0.00 TOTAL 0.00 0.00 0.00 BUDGET EXPENSES AVAILABLE Cultural Arts Totals 374,958.00 107,185.61 267,772.39 2 of 2 12 CITY OF NEWPORT BEACH CITY ARTS COMMISSION STAFF REPORT February 12, 2026 Agenda Item No. 4 RECOMMENDATION: Staff recommends that the City Arts Commission review the Final GPUSC/GPAC Draft Arts and Culture Element and Historical Resources Element, which have been revised to incorporate the Commission’s input from November 2025. The Commission should conduct a vote to consider recommending the City Council adopt them as part of the comprehensive General Plan Update later this year. BACKGROUND: The General Plan is a State-mandated, long-term policy document that guides a community’s physical development and informs local decision-making on land use, housing, transportation, infrastructure, parks, and related issues over a 20- to 30-year horizon. Newport Beach’s General Plan was last comprehensively updated in 2006, prompting the City Council to initiate a full review in 2019; however, the effort temporarily shifted to address the unprecedented 6th Cycle Regional Housing Needs Assessment (RHNA) and complete the Housing and Circulation Elements. As that work concluded, the City resumed the comprehensive update and, in the middle of 2022, the City Council established the three-member General Plan Update Steering Committee (GPUSC), chaired by Nancy Gardner, to guide the process and report to the City Council. In early 2023, the City Council also formed the General Plan Advisory Committee (GPAC), a 24-member community-based body chaired by Jeremy Evans and Arlene Greer, which organized subcommittees to support efficient and focused review of each General Plan element. This included the Arts and Culture/Historical Resources Subcommittee, composed of GPAC Members Dennis Baker, Rita Goldberg, and Paul Watkins, with GPAC Member Greer serving as the Subcommittee’s Chair. The General Plan Update effort has been broken into four primary phases, as described in Table 1 on the following page. Phase 3 (California Environmental Quality Act) is nearing completion with Phase 4 (Hearings) in progress. It is anticipated that the entire process will be completed by June 2026. TO: FROM: PREPARED BY: TITLE: CITY ARTS COMMISSION Library Services Department Melissa Hartson, Library Services Director (949) 717-3801, mhartson@newportbeachca.gov Ben Zdeba, Community Development Planning Manager General Plan Update: Final GPUSC/GPAC Draft Arts and Culture and Historical Resources Elements 13 General Plan Update: Final GPUSC/GPAC Draft Arts and Culture and Historical Resources Elements February 12, 2026 Page 2 Table 1, General Plan Update Process Phase 1 (Background Analysis + Visioning) Phase 2 (Policy Development + General Plan Amendment) Phase 3 (California Environmental Quality Act) Phase 4 (Hearings) • Community Engagement and Outreach Plan • Research and Data Analysis • Online Survey • GPAC + GPUSC Meetings • Pop-up Events • Paid Advertisements • Development of General Plan • Online Survey • GPAC+GPUSC Meetings • Community Workshops • Paid Advertisements • Virtual Open House • In-Person Open House • GPAC + GPUSC Meetings • Environmental Analysis • City Boards, Commissions, and Committees • City Council Adoption Completed late 2024 Completed late 2025 Open houses completed late 2025; Environmental analysis in progress In progress To get to the point of having initial drafts of the General Plan Elements available for review, City staff worked extensively with the GPAC Subcommittees, the GPAC, and the GPUSC. This started with the review of existing conditions and background analysis reports for each element. These documents are considered a “snapshot in time” to identify current condition in Newport Beach under each topical area as well as what needs to be addressed from a State requirement standpoint. Each subcommittee then worked on identifying a potential refresh for the individual elements and helped to create “ideas to support” them. These ideas were shared with the community through digital engagement on the City’s website for the effort (https://www.newportbeachca.gov/gpupdate), as well as at community workshops. Based on the feedback received, City staff alongside consultant Dudek refined the ideas shared as actual goals and accompanying policy statements in furtherance of each. The draft goals and policies were then shared with internal City staff from various departments for review prior to finalizing them as initial draft elements. These initial drafts were then reviewed by the Subcommittees, as well as the full GPAC and the GPUSC prior to being shared with the City’s boards, commissions, and committees for further input, and then advertised for additional public input from the broader community late last year. At a special joint meeting of the GPAC and the GPUSC on December 3, 2025, those Committees reviewed 56 comments received on various draft elements from six different City Boards, Commissions, and Committees, as well as 69 comments received from community members. Based on guidance received at that meeting, City staff returned to another special joint meeting on January 21, 2026, with a comprehensive set of revised draft elements. By a vote of 25 ayes to 1 nay, the GPAC and the GPUSC voted to move the draft forward as the Final GPUSC/GPAC Draft General Plan Update. This draft, including the Arts and Culture and Historical Resources Elements, represents the culmination of three years of diligent work by the GPAC, its subcommittees, the GPUSC, and engaged community members. Notably, the GPAC and the GPUSC combined for 57 meetings held in accordance with the Ralph M. Brown Act and 47 public meetings of the various Subcommittees. 14 General Plan Update: Final GPUSC/GPAC Draft Arts and Culture and Historical Resources Elements February 12, 2026 Page 3 DISCUSSION: The Arts and Culture Element and Historical Resources Element are both important and unique to Newport Beach but not required by State law. They serve to place emphasis on Newport Beach’s robust arts and culture offerings, and its important history. Together, they set forth a decision-making framework for the maintenance and enhancement of the City programming, as well as continuing to raise awareness and recognize the early beginnings and integral historical components that are meaningful to the community. The refreshed Arts and Culture Element includes updates that: support art in both public spaces and larger private development projects; offer enhanced policy support for City libraries and services; include policy support for musical and culinary arts programming; add a focus on marketing to engage the community; and emphasize collaboration with other organizations. The refreshed Historical Resources Element includes updates that: celebrate Newport Beach’s historical resources; encourage enhanced outreach, education, and interpretation of Newport Beach history through signage, partnerships, walking tours, and school programs; and consider the establishment of a legacy business program. The purpose of this item is to share those draft Elements, as revised by the GPAC and GPUSC to incorporate the Commission’s feedback from November 2025 (Attachments A and B). Attachment C is a table of the comments provided by the Commission along with a note on how each comment is addressed. City staff recommends the Commission review the updated drafts and conduct a vote to recommend the City Council adopt them as part of the comprehensive General Plan Update later this year. ENVIRONMENTAL REVIEW: The City Arts Commission’s action of making a recommendation to the City Council is exempt from the California Environmental Quality Act (CEQA) pursuant to Sections 15060(c)(2) (the activity will not result in a direct or reasonably foreseeable indirect physical change in the environment) and 15060(c)(3) (the activity is not a project as defined in Section 15378) of the CEQA Guidelines, California Code of Regulations, Title 14, Chapter 3, because it has no potential for resulting in physical change to the environment, directly or indirectly. An addendum to the Program Environmental Impact Report for the City of Newport Beach General Plan Housing Element Implementation Program is being prepared and will be provided for the City Council’s action on the General Plan Update. NOTICING: This agenda item has been noticed according to the Brown Act (72 hours in advance of the meeting at which the City Arts Commission considers the item). ATTACHMENT A: Final GPUSC/GPAC Draft Arts and Culture Element ATTACHMENT B: Final GPUSC/GPAC Draft Historical Resources Element ATTACHMENT C: Table of City Arts Commission Comments and Revisions 15 Attachment A Final GPUSC/GPAC Draft Arts and Culture Element 16 January 2026 AC-1 Arts and Culture Element PURPOSE The Arts and Culture Element focuses on enriching the community by bolstering art and culture through facilities, educational programming and activities, and events and festivals. OVERVIEW Art and culture play an important role in the social fabric of Newport Beach. The dedication and involvement of the City of Newport Beach (City) and the community have resulted in a wide range of art and culture organizations, resources, attractions, and activities that create a sense of community pride and enrichment. The Newport Beach Public Library offers robust art, culture, and literary programs, serving as a central hub for accessing and experiencing diverse forms of art and culture. GOALS, POLICIES, AND ACTIONS Engaging with Art and Culture Art, culture, literary and educational opportunities, and opportunities to be creative can enhance quality of life for residents, improve visitor experiences, and contribute to the local economy. Art and culture bring a unique sense of identity to Newport Beach, and can connect residents to each other and their community by expanding creative opportunities, promoting art and culture activities, and facilitating partnerships that support art and culture. Art and Culture Opportunities: Expanded art and culture opportunities can include new public art installations, culture events, culinary arts, and programs. Creating opportunities to engage with art and culture across Newport Beach can make art accessible to people of all backgrounds and generations. Promoting Art and Culture: Raising awareness and generating enthusiasm for the arts and culture are key to increasing participation in programs, exhibits, and events. This entails distributing marketing materials throughout Newport Beach, initiating social media campaigns, and creating new ways for people to engage in the arts through interactive technologies. A multifaceted approach that includes both traditional and novel outreach and engagement methods can capture the attention of residents and visitors of all ages. Strategic Partnerships: Partnerships are crucial for maintaining existing and realizing new opportunities to cultivate art and culture exhibits, programs, events, and funding. Strong coordination between City staff and private institutions, partner agencies, and local artist organizations can facilitate community involvement in art and culture, procurement of funding, and successful management of public art. Goal AC-1: A community enriched by and connected to the arts, culture, and education •Policy AC-1.1: Public Places. Promote arts and culture by incorporating art in widely used public places, such as parks, open spaces, public plazas, view sites, villages, and along corridors that attract visitors. (Imp. 1.1, 20.1, 20.3, 30.1) •Policy AC-1.2: Events and Programs. Attract new and cultivate existing signature events and programs that add to the quality of life for residents, enhance Newport Beach as a hub for art and culture, and stimulate economic activity. (Imp. 23.3, 29.2, 30.1) DR A F T 17 City of Newport Beach General Plan – Arts and Culture Element January 2026 AC-2 • Policy AC-1.3: Public Projects. Assess capital improvement projects for opportunities to incorporate public art in a manner that enhances community character and the built environment. (Imp. 1.1, 20.1, 23.3, 29.2, 30.1) • Policy AC-1.4: Private Projects. Develop regulations or incentives for the incorporation of public art into larger commercial projects that enhance Newport Beach’s community character and its built environment. (Imp. 1.1, 8.1, 8.2) • Policy AC-1.5: Shared Spaces. Acquire and display art in public facilities citywide to bolster civic pride and increase exposure to arts and culture. (Imp. 29.2) • Policy AC-1.6: Emerging Technologies. Explore and implement new technologies in art and culture displays, such as augmented reality and smartphone applications, to engage the public, track engagement, and enhance education about art and culture in innovative ways. (Imp. 29.2) • Policy AC-1.7: Arts Engagement. Incorporate artwork into the public realm that encourages interaction provides educational opportunities. This could include education for visitors in areas that attract tourists. (Imp. 1.1, 20.1, 23.3, 29.2, 30.1) • Policy AC-1.8: Planning Processes. Consider integration of public art into other City planning efforts, such as Specific Plans and Corridor Plans. (Imp. 3.1, 20.1, 29.2) • Policy AC-1.9: Educational Programming. Nurture creativity and artistic talent in local youth and adults through a rich offering of well-balanced and appropriately distributed arts, culture, and literary educational programs and services. (Imp. 23.3, 30.1) • Policy AC-1.10: Event Transportation. Coordinate with the Orange County Transportation Authority to explore options for the expansion of transportation services, such as trolleys, event-specific bus routes, or reduced transit fees, for major community art and culture events. (Imp. 14.4, 30.1) • Policy AC-1.11: Musical Arts. Continue to recognize and support musical performances as a vital community asset by providing increased opportunities for music in public spaces, signature music events, and other opportunities that highlight local talent and/or attract visitors. (Imp. 29.2, 30.1) Goal AC-2: Programs and exhibits in Newport Beach that are widely promoted, marketed, and attended • Policy AC-2.1: Arts Tourism. Promote reasonable tourism in Newport Beach to attract visitors and tourists interested in art, culture, and literary events to support and sustain local arts through coordination with the Chambers of Commerce and other community groups. (Imp. 24.1, 29.1) • Policy AC-2.2: Community Engagement. Conduct marketing through the City’s various social media and communications platforms to build public awareness and encourage participation in City-affiliated arts, culture, and literary activities. Cultivate partnerships with local businesses and other groups for marketing efforts for cultural arts. (Imp. 29.1, 29.2) • Policy AC-2.3: Promotional Banners. Develop and maintain regulations for the reasonable provision of banners on lights or other media materials in the public right-of-way to promote and advertise Newport Beach’s art and culture events across various villages and neighborhoods. (Imp. 8.1, 8.2, 29.1) • Policy AC-2.4: Arts Awareness. Expand awareness of art and culture by integrating public art and culture tours as a regular component of community engagement. (Imp. 23.3, 29.1, 29.2, 30.1) • Policy AC-2.5: Library Services. Improve and enhance existing library facilities, collections, and computer and related facilities, such as the Media Lab. (Imp. 23.2) DR A F T 18 City of Newport Beach General Plan – Arts and Culture Element January 2026 AC-3 Goal AC-3: Strong partnerships that support thriving arts, culture, and education • Policy AC-3.1: Educational Partnerships. Partner with the community and educational institutions to encourage and strengthen arts education for children, youth, adults, older adults, and people of all abilities throughout Newport Beach. (Imp. 14.2, 29.1) • Policy AC-3.2: Resources for Artists. Where available, provide reasonable in-kind resources and services, such as advertisements, equipment, security, and space, to artists and organizations offering programs for the public and contributing to art and culture in Newport Beach. (Imp. 29.2) • Policy AC-3.3: Public Support. Collaborate with local art and culture groups to pursue private and community sponsorships and donations for art and culture events and programs. (Imp. 29.1, 29.2) • Policy AC-3.4: Culinary Arts. Cultivate the culinary arts into City programs through partnerships with local restaurants, educational institutions, and other private and public partners that offer culinary expertise. (Imp. 14.2, 29.2, 30.1) Financing Art and Culture Investment from philanthropic organizations, the City, and community members can help the arts thrive by supporting local artists, providing new and upgraded facilities, and bolstering programs. Such financial contributions to the arts can increase the quantity and quality of art and arts programs in the community. Funding and investment should reflect the high value the community places on the arts. Goal AC-4: Funding that helps local artists and art programs flourish • Policy AC-4.1: Funding Support. Partner with, and reasonably support, non-profit, private, and community organizations in applying for public and private grants and promote community and business donations, fundraising, and sponsorships that support art, culture, and literary activities. (Imp. 29.1, 29.2) • Policy AC-4.2: Volunteer Support. Promote and support volunteer opportunities for public involvement in City-affiliated arts, culture, and literary programs and events. (Imp. 29.1, 29.2) • Policy AC-4.3: Geographical Partnerships. Utilize culture resources outside of Newport Beach through the promotion of programs, such as the Newport Beach Sister City Association and other cultural exchange programs. (Imp. 29.1, 29.2) • Policy AC-4.4: Grant Awards. Evaluate the impact of City art grant awards periodically. This could include review of awardee-submitted progress reports. (Imp. 30.1) Providing and Maintaining Arts and Cultural Facilities and Assets Facilities dedicated to the arts, such as galleries and performance halls (for example, Witte Hall), provide a place for the community to gather in appreciation of the arts and to promote Newport Beach as a regional destination for the arts. Additionally, integrating art into existing community centers, libraries, recreation facilities, parks and other open spaces, and private buildings plays a vital role in realizing Newport Beach as a community of the arts. Such assets must be well-maintained, and they require a well-functioning system for accepting, maintaining, and rotating art and art-related activities/programs through public spaces and facilities to help sustain interest and ensure the high quality of exhibits. Developing guidelines and criteria for accepting art donations and acquisitions and dedicating staff to manage public art can ensure that the system for managing art is consistent and operates smoothly. DR A F T 19 City of Newport Beach General Plan – Arts and Culture Element January 2026 AC-4 Goal AC-5: State-of-the-art facilities to host art exhibits and programs • Policy AC-5.1: Shared Venues. Explore opportunities to accommodate current and emerging culture and arts programs within existing and new facilities by working with community groups to facilitate sharing of performance and exhibit space. Consider the potential for new facilities. (Imp. 9.1, 29.1, 29.2) • Policy AC-5.2: New Facilities. Explore reasonable opportunities, as needed, to create a new, larger arts center to host performances and exhibitions. (Imp. 1.1) • Policy AC-5.3: Theaters. Maintain the Newport Theatre Arts Center while exploring opportunities to enhance, expand, or relocate the facility based on community needs. (Imp. 9.1, 29.1, 29.2) • Policy AC-5.4: Temporary Displays. Consider amendments to the Zoning Code, as needed, to facilitate the temporary or interim use of vacant ground-floor commercial or lobby space for art exhibits, display space, and “pop-up” art and culture activities. (Imp. 8.2) Goal AC-6: A wide collection of art exhibited throughout Newport Beach • Policy AC-6.1: Public Art Policy. Revise the City’s public art policy to (1) establish suitability criteria to guide the selection of sites for new and innovative public art installations in a manner that considers citywide needs and the balanced distribution of art throughout Newport Beach; (2) establish guidelines for the commissioning and conveyance of public art on private property; (3) refine guidelines and criteria for accepting art donations for display in public spaces, and consider establishing guidelines for storage and long-term maintenance; (4) consider an artwork acquisition plan for expanding the City’s permanent art inventory. (Imp. 8.2, 9.1) • Policy AC-6.2: Arts and Culture Plan. Pursue the adoption and regular updates to the 2014 Newport Beach Arts and Culture Master Plan, and report periodically on implementation progress to City Council. Identify future locations for public art citywide. (Imp. 8.2) • Policy AC-6.3: Staffing and Resources. Support the provision of reasonable staff resources for arts and culture programming, funding, arts management and maintenance, and coordination and communication with artists and City departments. (Imp. 30.1) DR A F T 20 Attachment B Final GPUSC/GPAC Draft Historical Resources Element 21 January 2026 HR-1 Historical Resources Element PURPOSE This Historical Resources Element focuses on the identification, documentation, preservation, and celebration of historical resources. OVERVIEW Historic preservation is essential for preserving the unique character, culture, and identity of Newport Beach. Efforts for historic preservation can strengthen resident ties to the community and enhance tourism for those who seek authentic cultural experiences and a deeper connection to Newport Beach’s rich history. By having systems in place to identify, preserve, and protect historical resources, the City of Newport Beach (City) is able to balance growth and development with the preservation of cultural and historical heritage while providing tangible benefits to the economy, environment, and the City’s residents and visitors. GOALS, POLICIES, AND ACTIONS Identification of Historical Resources Documenting and protecting archaeological and paleontological resources are crucial for preserving the evidence of human history and life forms of the distant past. These resources inform our understanding of ancient ecosystems and cultures. This stewardship fosters a culture of respect and responsibility, ensuring that future generations can continue to learn from and appreciate this history. Goal HR-1: Recognize and protect historically significant landmarks, sites, and structures • Policy HR-1.1: Historical Resources Inventory. Maintain and update the Newport Beach Register of Historical Property for buildings, objects, structures, and monuments having importance to the history or architecture of Newport Beach. (Imp. 9.1, 10.1, 29.2) • Policy HR-1.2: New Historical Resources. Encourage local residents to research and nominate properties for review by the City and/or Newport Beach Historical Society. (Imp. 29.1, 29.2) • Policy HR-1.3: Standards and Documentation. Consider developing standards for the review of demolition, grading, and building permits prior to granting City approval based on potential effects on historical resources. If demolition is granted, require photo documentation (in conformance with the standards outlined by the National Park Service’s Historic American Buildings Survey program) of inventoried historic structures prior to demolition. (Imp 2.1, 8.1, 8.2) • Policy HR-1.4: Preservation or Re-Use of Historical Structures. Encourage the preservation of structures listed in the National Register of Historic Places, the list of California Historical Landmarks, and/or the Newport Beach Register of Historical Property. Provide reasonable incentives, such as waivers of application fees, permit fees, and/or any liens placed by the City, for properties listed in the National Register of Historic Places, California Register of Historical Resources, or Newport Beach Register of Historical Property in exchange for preservation easements, designation applications, and other related preservation options. Partner with and reasonably support non-profit, private, and community organizations to apply for public DR A F T 22 City of Newport Beach General Plan – Historical Resources Element January 2026 HR-2 and private grants to help preserve and maintain historical resources throughout Newport Beach. (Imp. 8.2, 29.2) •Policy HR-1.5: Historic Context Statement. Consider preparing a Historic Context Statement to provide a consistent framework for evaluations and surveys. (Imp. 10.1, 29.2) •Policy HR-1.6: Citywide Survey. Every 10 years, or as needed, consider completing and updating a citywide historical resources survey to identify historical resources. Include community, neighborhood, cultural, and historic preservation groups; property owners; land developers; and the building industry in planning and implementing historical surveys. (Imp. 10.1, 29.2) •Policy HR-1.7: Streamlined Regulations. Consider provisions and policies related to historical resources under one ordinance in the Municipal Code to facilitate consistent application of the regulations and easier staff review. This may include the following: o Establish the National Park Service Secretary of the Interior’s Standards as the baseline City standard for project reviews, providing opportunity for certain projects to qualify for a categorical exemption under the California Environmental Quality Act (Class 31 Categorical Exemption). o Define categories of major and minor changes that would be subject to review, the review required, and the assigned decision-making body responsible for the associated determination. o Revise, consolidate, and better define the City’s classification system for historical resources to align with the Federal and State systems of classification. Streamline the process for how landmarks are considered for listing in the City’s classification system. One decision-making body (for example, the Planning Commission) should be given authority to review, conduct hearings, and make recommendations to City Council on the adoption of the historical resources designation. (Imp. 8.1, 8.2, 9.1) •Policy HR-1.8: Preservation Expertise. Consider supporting the provision of staff resources to hire or train a preservation planner to advise staff on matters related to historical resources. (Imp. 30.1) •Policy HR-1.9: Certified Local Government. Consider meeting the requirements for becoming a Certified Local Government, including adopting a historic preservation ordinance, establishing a qualified preservation review commission, providing adequate public participation in the historic preservation program, and completing other responsibilities identified by the State. (Imp. 29.2) Goal HR-2: Well-documented and protected archaeological and paleontological resources •Policy HR-2.1: Historical Records. Allow access to historical records among local preservation and cultural groups and among City departments and County of Orange agencies to the extent legally permissible. (Imp. 29.2) •Policy HR-2.2: Prehistoric and Ethnohistoric Context Statement. Consider completing, and updating as needed, a Prehistoric and Ethnohistoric Context Statement to serve as a template for identifying, evaluating, and developing plans for the treatment of archaeological resources found within Newport Beach. (Imp. 10.1, 29.2) •Policy HR-2.3: New Development Activities. Require that new development meet the applicable requirements of the California Environmental Quality Act with respect to paleontological and archaeological resources. (Imp. 11.1) DR A F T 23 City of Newport Beach General Plan – Historical Resources Element January 2026 HR-3 Preservation of Historical Resources Preserving the City’s history is essential for maintaining its unique identity and cultural heritage. By celebrating and safeguarding historically significant landmarks, sites, structures, and legacy businesses, the City can honor the stories and achievements of past generations. Further, by recognizing and celebrating those who have contributed to Newport Beach’s past, present, and future, our storied history can be captured. The recognition and protection of history not only enriches a community’s sense of place and continuity, but fosters civic pride and can attract tourism. Goal HR-3: Celebrate, preserve, and protect local history • Policy HR-3.1: Adaptive Reuse. Encourage alternatives to demolition of historical sites and structures by promoting architecturally compatible rehabilitation or adaptive reuse. Consider incentives for maintaining historical sites and structures, such as permit and application fee waivers, flexible building requirements, and free technical advice by person(s) qualified in historic preservation. (Imp. 8.2, 29.2) • Policy HR-3.2: Historical Components within New Projects. Encourage proposed development located on a historic site or structure to incorporate a physical link to the past within the site or structural design if preservation or adaptive reuse is not a feasible option. For example, consider incorporating historical photographs or artifacts within the new project or preserve the location and structures of existing pathways, gathering places, seating areas, rail lines, roadways, or viewing vantage points within the new site design. (Imp. 1.1, 29.2) • Policy HR-3.3: Mills Act. Consider development of a voluntary local Mills Act program to offset the ongoing stewardship and care of historic properties through property tax savings. (Imp. 8.2) • Policy HR-3.4: Legacy Businesses. Consider developing a legacy business program that aims to recognize, honor, and support longstanding businesses within the community that have made significant contributions to Newport Beach’s history, culture, and identity. The program may include the promotion of legacy businesses and potential grants. (Imp. 8.2) Celebrating Historical Resources Education is a key tool for enshrining the City’s history and ensuring that future generations appreciate and understand this heritage. Integrating local history into programs and events sponsored by the City, library, and others, and promoting it through various media can create a well-informed community that values its roots. This awareness not only enhances residents’ connection to Newport Beach, but also helps future generations value the past. The foundational history of tribal nations in the region provides unique insight into the importance of cultural places. Native American groups and individuals hold special interest in the protection of cultural places. Tribal views toward protection and preservation of cultural resources in Newport Beach should be respected, and the history of tribal nations should be recognized and acknowledged. Goal HR-4: Enshrine local history through education • Policy HR-4.1: Historical Landmarks. Encourage the placement of historical landmarks, photographs, markers, or plaques at areas of historical interest or value. Consider creating a Landmark Plan that will recognize and designate culturally important heritage sites that are eligible for the placement of historical landmarks or plaques. The Landmark Plan may also identify funding opportunities to support the program, such as development fees, corporate or civic sponsorships, or donations, or by using the City’s General Fund. (Imp. 8.2, 9.1, 10.1, 29.2) DR A F T 24 City of Newport Beach General Plan – Historical Resources Element January 2026 HR-4 • Policy HR-4.2: Local Interest. Consider expanding interest in and knowledge of local history through historic landmarks, photographs, markers, and plaques, and/or through self-guided walking tours as a means to promote and celebrate historic preservation. Such information may be published on the City’s website and social media channels and be made available through local publications to encourage thoughtful conversation about the history of Newport Beach. (Imp. 1.1, 29.1, 29.2, 30.1) • Policy HR-4.3: Historic Preservation and Tourism. Encourage collaboration with local preservation organizations, such as the Newport Beach Historical Society, to research, conduct outreach, and develop programs and activities to encourage and support historic preservation and tourism. (Imp. 14.16) • Policy HR-4.4: Educational Collaboration. Encourage collaboration with local educational institutions on preservation programs, activities, and exhibits/collections. (Imp. 14.2, 29.2) • Policy HR-4.5: Information Sharing. Consider encouragement of partnerships between local interested parties and historical societies to consolidate and share materials such as historical photographs, firsthand historical accounts and interviews, and any additional archival information. This may be done through the establishment of a City-recognized historical society or platform that welcomes representatives from various groups to share resources and collectively provide input to the City on historical resources. (Imp. 29.2) Goal HR-5: Celebrate tribal cultural resources • Policy HR-5.1: Government-to-Government Relationships. Encourage fostering government-to- government relationships with California Native American tribes in Newport Beach regarding issues of mutual concern. (Imp. 11.1) • Policy HR-5.2: Historic Themes. Consider the use of foundational local history themes in public spaces that highlight California Native American tribes, in coordination with tribal representatives. (Imp. 29.2) • Policy HR-5.3: Environmental Analysis. Require that new development meet the applicable requirements of the California Environmental Quality Act with respect to tribal cultural resources. (Imp. 11.1) DR A F T 25 Attachment C Table of City Arts Commission Comments and Revisions 26 City Boards, Commissions, and Committees Feedback GPAC/GPUSC Revisions from December 3, 2025 Prepared by Ben Zdeba, Planning Manager Table 1, City Arts Commission Feedback – Arts and Culture Element Element Goal/Section Comment(s) GPAC/GPUSC Revisions Arts and Culture AC-1: A community enriched by and connected to the arts, culture, and education N/A N/A Arts and Culture AC-2: Programs and exhibits in Newport Beach that are widely promoted, marketed, and attended Revise Policy AC-2.2 with the following addition: “Conduct marketing through the City’s various social media and communications platforms to build public awareness and encourage participation in City-affiliated arts, culture, and literary activities. Cultivate partnerships with local businesses and other groups for marketing efforts for cultural arts, (Imp. 29.1)” See Page AC-2. The additional sentence has been incorporated as suggested. Arts and Culture AC-3: Strong partnerships that support thriving arts, culture, and education Revise Policy AC-3.1 with the following addition: “Partner with the community and educational institutions to encourage and strengthen arts education for children, youth, adults, older adults and for people of all abilities throughout the city.” See Page AC-3. The additional language has been incorporated as suggested. Arts and Culture AC-4: Funding that helps local artists and art programs fiourish Revise Policy AC-4.1 with the following addition: “Partner with, and reasonably, support non-proflt, private, and community organizations in applying for public and private grants and promote community and business donations, fundraising and sponsorships that support art, culture, and literary activities. See Page AC-3. The additional language has been incorporated as suggested. Arts and Culture AC-5: State-of-the-art facilities to host art exhibits and programs N/A N/A Arts and Culture AC-6: A wide collection of art exhibited throughout Newport Beach Revise Policy AC-6.1 with the following addition: “Revise the City’s public art policy to (1) establish suitability criteria to guide the selection of sites for new and innovative public art installations in a manner that considers citywide needs and the balanced distribution of art throughout the city; (2) establish guidelines for the commissioning and conveyance of public art on private property; and (3) reflne guidelines and criteria for accepting art donations for display in public spaces and consider establishing guidelines for storage and long-term maintenance; and (4) consider an artwork acquisition plan for expanding the [C]ity’s permanent art inventory. (Imp. 8.2, 9.1)” See Page AC-4. Item (4) has been incorporated as suggested. 27 City Boards, Commissions, and Committees Feedback GPAC/GPUSC Revisions from December 3, 2025 Prepared by Ben Zdeba, Planning Manager Table 1, City Arts Commission Feedback – Arts and Culture Element Element Goal/Section Comment(s) GPAC/GPUSC Revisions Arts and Culture Not Specifled Add a new policy regarding the periodic re-evaluation of City Arts Grants for impact. See Page AC-3. New Policy AC-4.4 (Grant Awards) has been added. Arts and Culture Not Specifled Add a new policy about cultivating more culinary arts programs in the City. See Page AC-3. New Policy AC-3.4 (Culinary Arts) has been added. Arts and Culture Within “Goals, Policies, and Actions” under “Arts and Culture Opportunities” “Art and Culture Opportunities: Expanded art and culture opportunities can include new public art installations, culture events, culinary arts, and programs. Creating opportunities to engage with art and culture across Newport Beach can make art accessible to people of all backgrounds and generations.” See Page AC-1. “Culinary arts” has been incorporated as suggested. 28 City Boards, Commissions, and Committees Feedback GPAC/GPUSC Revisions from December 3, 2025 Prepared by Ben Zdeba, Planning Manager Table 2, City Arts Commission Feedback – Historical Resources Element Element Goal/Section Comment(s) Staff Response(s)/Recommendation Historical Resources HR-1: Recognize and protect historically signiflcant landmarks, sites, and structures Revise Policy HR-1.4 with the following addition: “Encourage the preservation of structures listed in the National Register of Historic Places, and/or the list of California Historical Landmarks, and/or the Newport Beach Register of Historical Property. Provide reasonable incentives, such as waivers of application fees, permit fees, and/or any liens placed by the City for properties listed in the National Register of Historic Places, State Register, or the Newport Beach Register of Historical Property in exchange for preservation easements, designation applications, and other related preservation incentives. Partner with and reasonably support non-proflt, private and community organizations in applying for public and private grants that would preserve and maintain historical resources throughout the city.” (Imp. 8.2, 29.2) See Page HR-1. The additional sentence has been incorporated as suggested. Historical Resources HR-2: Well-documented and protected archaeological and paleontological resources N/A N/A Historical Resources HR-3: Celebrate, preserve, and protect local history N/A N/A Historical Resources HR-4: Enshrine local history through education Make the following revision to Policy HR-4.3: “Encourage collaboration with local preservation organizations, like the Newport Beach Historical Society, to research, conduct outreach, and develop programs and activities to encourage and support historic preservation and cultural historical tourism. (Imp. 14.16)” See Page HR-4. “Cultural” was removed and the Policy has been revised to read “… and support historic preservation and tourism.” Historical Resources HR-5: Celebrate tribal cultural resources N/A N/A Historical Resources Within the “Overview.” Add a sentence about tourism. See Page HR-1. “Tourism” has been included in the Overview. 29 CITY OF NEWPORT BEACH CITY ARTS COMMISSION STAFF REPORT February 12, 2026 Agenda Item No. 5 ABSTRACT: The sum of $30,000 is provided for specific cultural or artistic programs as approved by the City Council. The City Arts Commission has the responsibility to review all programs and requests for support from arts groups and make recommendations for funding to the City Council for final approval. RECOMMENDATION: Staff recommend that the City Arts Commission review the grant applications and approve the Cultural Arts Grants Ad Hoc Subcommittee’s recipients for recommendation to the City Council for the Fiscal Year (FY) 2025-26 Cultural Arts Grants in accordance with City Council Policy I-10, Culture and Arts Grants. FUNDING REQUIREMENTS: The current adopted budget includes sufficient funding for this expenditure. Funds will be expensed from the Cultural Arts Grants budget. DISCUSSION: City Council Policy I-10, Culture and Arts Grants, recognizes the importance of promoting culture and the arts within the City. The sum of $30,000 has been provided in the FY 2025-26 budget for specific cultural or artistic programs as approved by the City Council. The City Arts Commission has the responsibility to review all programs and requests for support from arts groups and make recommendations for funding to the City Council for final approval. The Commission received written grant proposals from eight organizations requesting funding of $34,700 in free cultural arts programming for the Newport Beach Community in 2026. Grant applications include: TO: CITY ARTS COMMISSION FROM: Library Services Department Melissa Hartson, Library Services Director (949) 717-3801, mhartson@newportbeachca.gov PREPARED BY: Rebecca Lightfoot, Library Services Manager TITLE: Cultural Arts Grants Fiscal Year 2025-26 30 Cultural Arts Grants FY 2025-26 February 12, 2026 Page 2 ORGANIZATION REQUEST RECOMMENDED AMOUNT ATTACHMENT Backhausdance $4,000 $4,000 A Baroque Music Festival, Corona del Mar $4,500 $4,500 B Choral Arts Initiative $3,500 $3,000 C Emerald Magic Events Inc. $5,000 $4,000 D Pacific Chorale $5,000 $5,000 E Pacific Symphony $5,000 $5,000 F South Coast Repertory $5,000 $3,000 G Wildlife Jewels $2,700 $1,500 H TOTAL FUNDING $34,700 $30,000 NOTICING: This agenda item has been noticed according to the Brown Act (72 hours in advance of the meeting at which the City Arts Commission considers the item). ATTACHMENT A--H: FY 2025-26 Cultural Arts Grants Applications ATTACHMENT I: Summary of Cultural Arts Grant Applications ATTACHMENT J: City Council Policy I-10—Cultural Arts Grants 31 &&XOWXUDO$UWV*UDQWV$SSOLFDWLRQ)RUP 5HIHUHQFH 6WDWXV &RPSOHWH /RJLQ8VHUQDPH QDQF\#EDFNKDXVGDQFHRUJ /RJLQ(PDLO QDQF\#EDFNKDXVGDQFHRUJ 3RSXODU1DPHRI2UJDQL]DWLRQ %DFNKDXVGDQFH /HJDO1DPHLIGLIIHUHQW%DFNKDXV'DQFH )HGHUDO7D[,'1R 0DLOLQJ$GGUHVV 32%R[ &LW\=LSFRGH 2UDQJH &RQWDFW1DPH 1DQF\:DU]HU%UDG\ 3KRQHQXPEHU (PDLODGGUHVV QDQF\#EDFNKDXVGDQFHRUJ :HEVLWH ZZZEDFNKDXVGDQFHRUJ *HRJUDSKLFDO$UHD6HUYHG 1HZSRUW%HDFK2UDQJH&RXQW\6RXWKHUQ&$ +DYH\RXUHFHLYHGD&LW\RI1HZSRUW%HDFK &XOWXUDO$UWV*UDQWEHIRUH" <HV ,IVRZKDW\HDUGLG\RXUHFHLYHDJUDQW" <HDURUJDQL]DWLRQZDVIRXQGHG 1XPEHURISDLGVWDII 1XPEHURIDFWLYHYROXQWHHUV 7RWDODPRXQWUHTXHVWHGIURPUHTXHVWOLQHRI SURMHFWEXGJHW (VWLPDWHGQXPEHURISHRSOHLQ1HZSRUW%HDFK WKDWWKHSURSRVHGSURMHFWVZLOOVHUYH 2YHUYLHZ )RXQGHGLQE\DZDUGZLQQLQJ %ULHIO\GHVFULEHEHORZ\RXURUJDQL]DWLRQ V SXUSRVHPLVVLRQDQGJRDOV 1 of 23 ATTACHMENT A 32 FKRUHRJUDSKHU-HQQLIHU%DFNKDXVD1HZSRUW %HDFKUHVLGHQWDQG&KDSPDQ8QLYHUVLW\GDQFH IDFXOW\PHPEHU%DFNKDXVGDQFHLV2UDQJH &RXQW\ಬVSUHPLHUFRQWHPSRUDU\GDQFHFRPSDQ\ DQGDQDWLRQDOO\UHFRJQL]HGOHDGHULQ SHUIRUPDQFHHGXFDWLRQDQGFRPPXQLW\ HQJDJHPHQW2YHUWKHSDVWWZRGHFDGHVWKH FRPSDQ\KDVHDUQHGDUHSXWDWLRQIRUDUWLVWLF H[FHOOHQFHLQQRYDWLYHFKRUHRJUDSK\DQG PHDQLQJIXOHGXFDWLRQDOSURJUDPPLQJWKDW FRQQHFWVSHRSOHRIDOODJHVWRFRQWHPSRUDU\ GDQFH $QQXDOO\%DFNKDXVGDQFHSUHVHQWVRULJLQDO ZRUNVLQWKHDWHUVDQGRXWGRRUYHQXHVWKURXJKRXW 2UDQJH&RXQW\DQG6RXWKHUQ&DOLIRUQLD LQFOXGLQJ6KHUPDQ/LEUDU\ *DUGHQVLQ&RURQD GHO0DUZKLOHPDLQWDLQLQJDVWURQJORFDO SUHVHQFHLQ1HZSRUW%HDFKVFKRROVDQG FRPPXQLW\VHWWLQJV7KHFRPSDQ\LVFRPSULVHG RISURIHVVLRQDOGDQFHUVIRXUDUWLVWLFDQG HGXFDWLRQVWDIIPHPEHUVDGHGLFDWHG%RDUGRI 'LUHFWRUVDQGDFWLYHYROXQWHHUV1RZFHOHEUDWLQJ RXUUGVHDVRQದ%DFNKDXVGDQFH FRQWLQXHVWRJURZDUWLVWLFDOO\DQGRUJDQL]DWLRQDOO\ GHVSLWHRSHUDWLQJZLWKRXWDSHUPDQHQWVWXGLRRU RIILFH $WWKHFRUHRI%DFNKDXVGDQFHಬVZRUNLVD FRPPLWPHQWWRDFFHVVLELOLW\HTXLW\DQG LQFOXVLRQHQVXULQJWKDWFRQWHPSRUDU\GDQFHLV DYDLODEOHWRGLYHUVHFRPPXQLWLHVDFURVV JHQHUDWLRQVDQGOLYHGH[SHULHQFHV 0LVVLRQ3XUSRVHDQG*RDOV 7KHPLVVLRQRI%DFNKDXVGDQFHLVWRFUHDWH SHUIRUPDQGVKDUHLQQRYDWLYHFRQWHPSRUDU\ GDQFHWKDWLQVSLUHVFKDOOHQJHVDQGXSOLIWV:H 2 of 23 33 EHOLHYHLQWKHWUDQVIRUPDWLYHSRZHURIGDQFHWR IRVWHUMR\ZHOOQHVVFUHDWLYHH[SUHVVLRQDQG KXPDQFRQQHFWLRQ7KURXJKDQLQWHJUDWHG DSSURDFKWKDWFRPELQHVSURIHVVLRQDO SHUIRUPDQFHPXOWLJHQHUDWLRQDOHGXFDWLRQDQG FRPPXQLW\HQJDJHPHQW%DFNKDXVGDQFH FXOWLYDWHVHQYLURQPHQWVZKHUHSDUWLFLSDQWVDQG DXGLHQFHVDOLNHDUHDFWLYHFRQWULEXWRUVWRWKH FUHDWLYHSURFHVV (GXFDWLRQLVFHQWUDOWRRXUPLVVLRQ %DFNKDXVGDQFHLVGHGLFDWHGWRLQWURGXFLQJ VWXGHQWVDQGWKHFRPPXQLW\RIDOODJHVDQG DELOLWLHVWRFRQWHPSRUDU\GDQFHQXUWXULQJ FUHDWLYLW\DQGH[SDQGLQJFXOWXUDO XQGHUVWDQGLQJಧSDUWLFXODUO\IRUWKRVHZKRPD\ QRWRWKHUZLVHKDYHDFFHVVWRSURIHVVLRQDODUWV H[SHULHQFHV2XUSURJUDPVHPSRZHUHPHUJLQJ DUWLVWVWKURXJKRSSRUWXQLWLHVVXFKDVRXUDQQXDO WKUHHZHHN6XPPHU,QWHQVLYHZKLFKRIIHUV VFKRODUVKLSVWRWHHQVXQLYHUVLW\OHYHOVWXGHQWV DQGSURIHVVLRQDOGDQFHUV 7KURXJKORQJWHUPSDUWQHUVKLSVZLWKVFKRROV KLJKHUHGXFDWLRQLQVWLWXWLRQVORFDOFLW\ JRYHUQPHQWVFRPPXQLW\RUJDQL]DWLRQVDQGDUWV YHQXHV%DFNKDXVGDQFHGHOLYHUVKLJKTXDOLW\ LPSDFWIXODUWVH[SHULHQFHVWKDWVWUHQJWKHQ FRPPXQLWLHVDQGLQVSLUHIXWXUHSDWKZD\VLQWKH DUWV$NH\RUJDQL]DWLRQDOJRDOLVWRH[SDQG FRQWHPSRUDU\GDQFHHGXFDWLRQDQGDFFHVV ZLWKLQ1HZSRUW%HDFKDGYDQFLQJRXUEHOLHILQ ಯGDQFHHYHU\GD\IRUHYHU\ERG\ರ ,GHQWLI\DQGGHVFULEHZK\WKHUHLVDQHHGLQ WKH1HZSRUW%HDFK&RPPXQLW\IRU\RXU SURSRVHGSURMHFWSURJUDP,QFOXGHDTXDQWLWDWLYH GHVFULSWLRQRIWKHQHHGDQGRQZKDW\RXEDVHG $FFHVVWRSURIHVVLRQDOFRQWHPSRUDU\ GDQFHಧERWKSHUIRUPDQFHVDQGLQVFKRRO WUDLQLQJಧLVH[WUHPHO\OLPLWHGLQ1HZSRUW%HDFK :KLOHVRPHVFKRROVPD\KRVWRFFDVLRQDOJXHVW 3 of 23 34 \\RXUILQGLQJVLHಯ%DVHGRQDVWXG\GRQHE\WKH 37$WKHUHDUHRQHKXQGUHGFKLOGUHQLQWKHWK WKJUDGHVDW1HZSRUW(OHPHQWDU\ZKRKDYHKDG QRWUDLQLQJZLWKPXVLFDOLQVWUXPHQWVರ'HVFULEH KRZ\RXKDYHGHWHUPLQHGWKDW\RXURUJDQL]DWLRQ LVWKHEHVWRUJDQL]DWLRQIRUWKHSURSRVHGSURMHFW SURJUDP FKRUHRJUDSKHUVRUVLQJOHZRUNVKRSVVWXGHQWV UDUHO\KDYHRSSRUWXQLWLHVWRSDUWLFLSDWHLQPXOWL ZHHNFXUULFXOXPEDVHGUHVLGHQFLHVWKDWSURYLGH VHTXHQWLDOLQVWUXFWLRQFUHDWLYHGHYHORSPHQWDQG PHDQLQJIXOSURIHVVLRQDOPHQWRUVKLSGXULQJWKH DFDGHPLFGD\ %DFNKDXVGDQFHLVFXUUHQWO\WKHRQO\SURIHVVLRQDO FRQWHPSRUDU\GDQFHFRPSDQ\RIIHULQJDQLQ GHSWKUHVLGHQF\RIWKLVVFRSHZLWKLQ1HZSRUW %HDFKVHFRQGDU\VFKRROV:LWKVXSSRUWIURPD JHQHURXV&XOWXUDO$UWV*UDQWIURPWKH1HZSRUW %HDFK&LW\$UWV&RPPLVVLRQWKHSURJUDPLV RIIHUHGDWQRFRVWWRWKHVFKRROVUHPRYLQJ ILQDQFLDOEDUULHUVDQGHQVXULQJHTXLW\DQG LQFOXVLYHQHVV:LWKRXWWKLVVXSSRUWVWXGHQWV ZRXOGQRWRWKHUZLVHUHFHLYHWKLVOHYHORI VXVWDLQHGHQJDJHPHQWZLWKSURIHVVLRQDODUWLVWV RYHUDWKUHHPRQWKSHULRG 2XUSURSRVHGSURJUDPಯ'DQFH([SUHVVLRQV &UHDWLYLW\DQG&KRUHRJUDSK\ರSURYLGHVDGLVWLQFW DQGLPSDFWIXODUWVH[SHULHQFHIRU1HZSRUW%HDFK VWXGHQWVHGXFDWRUVDQGWKHEURDGHUFRPPXQLW\ )RUPRVWSDUWLFLSDQWVWKLVLVWKHRQO\WLPHWKH\ KDYHKDGWRZRUNZLWKDSURIHVVLRQDO FRQWHPSRUDU\GDQFHFRPSDQ\ಧDQH[SHULHQFH WKDWSURPRWHVSK\VLFDODQGHPRWLRQDOZHOOEHLQJ VRFLDOFRQQHFWLRQDFDGHPLFPRWLYDWLRQDQG VSDUNVFXULRVLW\DERXWIXWXUHVWXG\RUFDUHHUVLQ WKHDUWV 7KHUHVLGHQF\GLUHFWO\HQJDJHVPLGGOHDQG KLJKVFKRROVWXGHQWVWKURXJKLQVFKRRO ZRUNVKRSVDQGH[SDQGVLWVUHDFKWKURXJKWZR SURIHVVLRQDOFRPSDQ\DVVHPEOLHVLQWURGXFLQJDQ DGGLWLRQDOVWXGHQWVWRFRQWHPSRUDU\GDQFH DWWKH6HD.LQJ7KHDWHUDW&RURQDGHO 4 of 23 35 0DU0LGGOH+LJK6FKRRO7KHVHSHUIRUPDQFHV LQFOXGHGLVFXVVLRQRIFKRUHRJUDSK\PXVLF OLJKWLQJDQGSURGXFWLRQHOHPHQWVDVZHOODV LQWHUDFWLYH4 $VHVVLRQVZLWKWKHGDQFHUV)RU PRVWVWXGHQWVWKLVLVWKHLU LQDXJXUDO HQFRXQWHU ZLWKVHHLQJFRQWHPSRUDU\GDQFHRUD SURIHVVLRQDOGDQFHSHUIRUPDQFHRIDQ\NLQGLQD VFKRROWKHDWHUVHWWLQJRUDQ\ZKHUH 7KHSURJUDPFXOPLQDWHVLQWKH)DOO &KRUHRJUDSK\6KRZFDVHDW&RURQDGHO0DU 0LGGOH+LJK6FKRROZKHUHVWXGHQWFUHDWHG ZRUNVDUHVKDUHGZLWKSHHUVIDPLOLHVDQG FRPPXQLW\PHPEHUV:LWKDSSUR[LPDWHO\ DXGLHQFHPHPEHUVDWWHQGLQJWKH6KRZFDVH RIIHUVDSRZHUIXORSSRUWXQLW\IRUWKHFRPPXQLW\ WRVHHWKHRXWFRPHVRIWKHUHVLGHQF\WR H[SHULHQFHDQGFHOHEUDWHVWXGHQWJURZWK FUHDWLYLW\WKHYDOXHRIVXVWDLQHGDUWVHGXFDWLRQ DQGWKHRQJRLQJQHHGIRUH[SDQGHGGDQFHDQG FXOWXUDOHQULFKPHQWLQ1HZSRUW%HDFK 'DQFH([SUHVVLRQVSURYLGHVDYLWDOSK\VLFDO DQGFUHDWLYHRXWOHWIRUWHHQVQDYLJDWLQJ LQFUHDVLQJDFDGHPLFDQGVRFLDOSUHVVXUHV LQFOXGLQJKHLJKWHQHGDQ[LHW\DQGGHSUHVVLRQ 5HVHDUFKLQFOXGLQJVFLHQWLILFVWXGLHVLQWKHILHOG RIDUWVDQGZHOOQHVVUHIOHFWWKHVWURQJFRSLQJ UHFRYHU\DQGSK\VLFDODQGPHQWDOKHDOWKEHQHILWV DVVRFLDWHGZLWKSDUWLFLSDWLQJLQRUDWWHQGLQJDQ DUWVHYHQWRUFUHDWLYHH[SHULHQFH$GGLWLRQDO VWXGLHVVXFKDV'DQFH&RXQWVE\WKH$UWV (GXFDWLRQ3DUWQHUVKLSDQGILQGLQJVIURPWKH 1DWLRQDO'DQFH(GXFDWLRQ$VVRFLDWLRQDQG $PHULFDQ&ROOHJH'DQFH$VVRFLDWLRQ GHPRQVWUDWHFOHDUOLQNVEHWZHHQGDQFH SDUWLFLSDWLRQDQGSRVLWLYHSV\FKRORJLFDO FRJQLWLYHDQGVRFLDORXWFRPHVLQFOXGLQJ 5 of 23 36 FUHDWLYLW\GLVFLSOLQHFROODERUDWLRQDQGHPSDWK\ 7KHVHHVVHQWLDOVNLOOVVXSSRUWVWXGHQWJURZWK FROOHJHDQG FDUHHUUHDGLQHVVDQGWKHGHYHORSPHQWRID KHDOWK\DGDSWDEOHZRUNIRUFHDQGVRFLHW\ )XOILOOLQJWKLVFULWLFDOQHHG'DQFH([SUHVVLRQV HPSRZHUVRXUQH[WJHQHUDWLRQ 'DQFH([SUHVVLRQVSURPRWHVFRPPXQLW\ LQYROYHPHQWDQGDZDUHQHVVRIWKHDUWVLQ 1HZSRUW%HDFKE\ 3URYLGLQJHTXLWDEOHDFFHVVWRSURIHVVLRQDO FRQWHPSRUDU\GDQFHHGXFDWLRQGXULQJWKHVFKRRO GD\ (QJDJLQJIDPLOLHVDQGUHVLGHQWVWKURXJKSXEOLF VWXGHQWSHUIRUPDQFHV ,QWURGXFLQJKXQGUHGVRIVWXGHQWVDQGDXGLHQFH PHPEHUVWRFRQWHPSRUDU\GDQFHDVDOLYLQJDUW IRUPDQGSRWHQWLDOFDUHHUSDWKZD\V %H\RQGWKHVFKRROV%DFNKDXVGDQFHKDVD GHPRQVWUDWHGKLVWRU\RIHQULFKLQJWKH1HZSRUW %HDFKFRPPXQLW\WKURXJKDFFHVVLEOH FRQWHPSRUDU\GDQFHSURJUDPPLQJDIUHH SHUIRUPDQFHDWWKH1HZSRUW%HDFK&LYLF&HQWHU DQG*DUGHQ)ORZDW 6KHUPDQ/LEUDU\DQG*DUGHQV7RJHWKHUWKHVH HIIRUWVUHIOHFWDVXVWDLQHGFRPPLWPHQWWRVHUYLQJ WKHFRPPXQLW\WKURXJKGDQFH%\DGGUHVVLQJD FOHDUJDSLQDUWVHGXFDWLRQDQGFXOWXUDO HQULFKPHQW'DQFH([SUHVVLRQVHQULFKHVWKH OLYHVRIVWXGHQWVDQGUHVLGHQWVZKLOHVHUYLQJDVD PRGHOIRUH[SDQGHGSURJUDPPLQJLQ1HZSRUW %HDFKVFKRROVDQGFRPPXQLW\VSDFHVLQWKH IXWXUH 'HVFULEHWKHVSHFLILFSURMHFWSURJUDPWKDWZLOO EHIXQGHGE\DFXOWXUDOJUDQW,QFOXGHKRZWKH %DFNKDXVGDQFHSURSRVHVWRSUHVHQWಯ'DQFH ([SUHVVLRQV&UHDWLYLW\DQG&KRUHRJUDSK\D 6 of 23 37 SSURSRVHGSURMHFWSURJUDPZLOOEHLPSOHPHQWHG DQGRXWOLQHDVFKHGXOHRUSURMHFWWLPHOLQHZLWK SODQQHGGDWHVDQGORFDWLRQV,GHQWLI\LQGLYLGXDOV DQGJURXSVLQYROYHGSDUWLFXODUO\DUWLVWVDQG SHUIRUPHUVDQGGHVFULEHWKHLUUROHVDQG UHVSRQVLELOLWLHV'HVFULEHWKHEDFNJURXQGDQG TXDOLILFDWLRQVRI\RXURUJDQL]DWLRQDQGNH\ SHUVRQQHOWREHLQYROYHGLQWKHSURJUDP 5HPHPEHUWKH&LW\IXQGVRQO\SURMHFWVDQG SURJUDPVQRWRSHUDWLQJH[SHQVHV7KHVH SURMHFWVDQGSURJUDPVPXVWSURPRWHFRPPXQLW\ LQYROYHPHQWDQGDZDUHQHVVRIWKHDUWVLQ 1HZSRUW%HDFK VFKRROFRPPXQLW\EDVHGFRQWHPSRUDU\GDQFH UHVLGHQF\LQSDUWQHUVKLSZLWK1HZSRUW0HVD 8QLILHG6FKRRO'LVWULFW1086'VHFRQGDU\ VFKRROV&RURQDGHO0DU0LGGOH+LJK6FKRRO &'0%DFN%D\+LJK6FKRRO%%DQG 1HZSRUW+DUERU+LJK6FKRRO1++6WDNLQJ SODFH6HSWHPEHUದ'HFHPEHU ಯ'DQFH([SUHVVLRQVರLVDPXOWLZHHNVWUXFWXUHG FXUULFXOXPEDVHGUHVLGHQF\LPSOHPHQWHGGXULQJ WKHDFDGHPLFGD\SURYLGLQJVHTXHQWLDO LQVWUXFWLRQFUHDWLYHGHYHORSPHQWDQGGLUHFW PHQWRUVKLSZLWKSURIHVVLRQDOGDQFHUV7KURXJK FRQWHPSRUDU\GDQFHZRUNVKRSVSHUIRUPDQFH DQGD)DOO&KRUHRJUDSK\6KRZFDVHWKHSURJUDP ZLOOVHUYHDSSUR[LPDWHO\1HZSRUW%HDFK VWXGHQWVDQGFRPPXQLW\PHPEHUV7KHSURJUDP OHGE\WKHLUDZDUGZLQQLQJORFDOSURIHVVLRQDO FRQWHPSRUDU\GDQFHFRPSDQ\LQWURGXFHV VWXGHQWVWR%DFNKDXVGDQFHWHFKQLTXH FKRUHRJUDSK\LPSURYLVDWLRQFRPSRVLWLRQ SDUWQHULQJPRYHPHQWYRFDEXODU\DQG SHUIRUPDQFHSUHVHQWDWLRQDQGWKHMR\RIGDQFH %DFNKDXVGDQFHLQVWUXFWRUVLQFROODERUDWLRQZLWK WKHVWXGHQWVZLOOGHYHORSQHZFKRUHRJUDSK\IRU WKH)DOO6WXGHQW&KRUHRJUDSK\6KRZFDVH SHUIRUPDQFHVDW&G0IRU1HZSRUW%HDFK UHVLGHQWVDQGWKHSXEOLF1RYHPEHU 'DQFH([SUHVVLRQVSDUWLFLSDQWVZLOOJDLQ XQGHUVWDQGLQJRQKRZWRH[SUHVVWKHLUFUHDWLYLW\ HPRWLRQVWHOOVWRULHVDQGFRPPXQLFDWHWKURXJK GDQFHZKLOHH[SORULQJFDUHHUSDWKZD\VLQWR SURIHVVLRQVLQWKHSHUIRUPLQJDUWV 3URMHFW7LPHOLQHDQG,PSOHPHQWDWLRQ 3ODQQLQJ &RRUGLQDWLRQ$XJXVW 6HSWHPEHU 7 of 23 38 %DFNKDXVGDQFHDUWLVWLFDQGHGXFDWLRQVWDIIZLOO PHHWZLWKGDQFHHGXFDWRUVDQGDGPLQLVWUDWRUVDW HDFKSDUWLFLSDWLQJVFKRROWRILQDOL]HVFKHGXOHV FXUULFXOXPIRFXVDQGSHUIRUPDQFHORJLVWLFV 'DQFH([SUHVVLRQV:RUNVKRSV6FKHGXOH D&RURQDGHO0DU0LGGOH+LJK6FKRRO 7RWDORIZRUNVKRSVPLQXWHVHDFKVHW FKRUHRJUDSK\IRUVWXGHQWSHUIRUPDQFHVLQ 1RYHPEHU %UHDNGRZQ7XHVGD\7KXUVGD\V 'DWHVZHHNV ZRUNVKRSV SHULRGDPDP'DQFHPLGGOH VFKRRODQGSHULRGDPSP'DQFH PLGGOHVFKRRODYHUDJHVWXGHQWVSHUFODVV %UHDNGRZQ:HGQHVGD\V)ULGD\V 'DWHVZHHNV ZRUNVKRSV 'DQFHKLJKVFKRROSHULRGDP DP'DQFHKLJKVFKRROSHULRG DPSPDYHUDJHVWXGHQWVSHUFODVV E%DFN%D\7ZRRQHKRXUZRUNVKRSVIRURQH FODVVRIVWXGHQWVLQJUDGHV7XHVGD\ DQG7KXUVGD\SHULRG DPSP F1++67ZRRQHKRXUZRUNVKRSVIRUWZR FODVVHVRIVWXGHQWVLQJUDGHVVWXGHQWV SHUFODVV:HGQHVGD\SHULRG DPDPDQGSHULRGDPSP 'DQFH([SUHVVLRQV3HUIRUPDQFHV $VVHPEOLHV2FWREHU 8 of 23 39 +HOGLQWKH6HD.LQJ7KHDWUHDW&G0RQ 7KXUVGD\2FWREHUDPDP DQGDPDPWKHHQWLUH %DFNKDXVGDQFHFRPSDQ\SHUIRUPVQHZ UHSHUWRU\IRU6HDVRQZLWKIDFLOLWDWHG GLVFXVVLRQE\-HQQLIHU %DFNKDXVDUWLVWLFGLUHFWRUDQG$PDQGD.D\ :KLWHDVVRFLDWHDUWLVWLFGLUHFWRUWREUHDNGRZQ WKHGDQFHPRYHPHQWSKUDVHVSURGXFWLRQ OLJKWLQJFRVWXPHVDQGPXVLFDOHOHPHQWVZLWK TXHVWLRQ DQVZHUVHVVLRQEHWZHHQGDQFHUVDQG DXGLHQFH,QYLWDWLRQVDUHVHQWWRDGGLWLRQDO&G0 %%DQG1086'KLJKVFKRROVZLWKWUDQVSRUWDWLRQ SURYLGHGE\1086'$GGLWLRQDOJXHVWVLQFOXGH &G0DGPLQLVWUDWRUV1086'6FKRRO%RDUG PHPEHUV1HZSRUW%HDFK$UWV&RPPLVVLRQDQG %DFNKDXVGDQFH%RDUGPDQ\DUH1HZSRUW %HDFKUHVLGHQWV $UWLVWV3HUVRQQHO 4XDOLILFDWLRQV 7KHUHVLGHQF\LVOHGE\-HQQLIHU%DFNKDXV IRXQGHUDQGDUWLVWLFGLUHFWRURI%DFNKDXVGDQFH ZLWKRYHU\HDUVRISURIHVVLRQDODQG HGXFDWLRQDOOHDGHUVKLS$PDQGD.D\:KLWH $VVRFLDWH$UWLVWLF'LUHFWRUVXSSRUWVFXUULFXOXP GHVLJQWHDFKLQJDQGSHUIRUPDQFHIDFLOLWDWLRQ :RUNVKRSVDUHWDXJKWE\VHDVRQHGSURIHVVLRQDO %DFNKDXVGDQFHGDQFHUVDQGWHDFKLQJDUWLVWV ZLWKH[WHQVLYHH[SHULHQFHLQ\RXWKHGXFDWLRQ FRPPXQLW\HQJDJHPHQWDQGFRQWHPSRUDU\ GDQFHSHUIRUPDQFH%DFNKDXVGDQFHFRPSDQ\ PHPEHUVZLOOSHUIRUPDQGHQJDJHLQGLDORJXH ZLWKVWXGHQWVDQGHGXFDWRUVDIWHUHDFK DVVHPEO\ 1DQF\:DU]HU%UDG\GLUHFWRURIHGXFDWLRQ FRPPXQLW\HQJDJHPHQWRYHUVHHVUHVLGHQF\ 9 of 23 40 FXUULFXOXPVFKRROSDUWQHUVKLSVVFKHGXOLQJDQG SURJUDPLPSOHPHQWDWLRQZRUNLQJFORVHO\ZLWK 1086'HGXFDWRUVDQGDGPLQLVWUDWRUVWRHQVXUH SURJUDPTXDOLW\DFFHVVLELOLW\DQGPHDQLQJIXO FRPPXQLW\LPSDFW 7KH&XOWXUDO$UWV*UDQWZLOOIXQGDSRUWLRQRIWKH 'DQFH([SUHVVLRQVUHVLGHQF\ VSURMHFWVSHFLILF H[SHQVHVIRUSURIHVVLRQDOFRQWHPSRUDU\ GDQFHUVWHDFKLQJDUWLVWVLQZRUNVKRSVDQG SHUIRUPDQFHVHQVXULQJWKDW1HZSRUW%HDFK VWXGHQWVDQGUHVLGHQWVEHQHILWIURPDKLJK TXDOLW\XQIRUJHWWDEOHDQGSRVLWLYHDUWVHGXFDWLRQ H[SHULHQFHPDNLQJDVLJQLILFDQWLPSDFWIRUWKH DUWVLQ1HZSRUW%HDFK ,,VWKLVDQHZRUH[LVWLQJSURMHFWSURJUDP"([LVWLQJSURJUDP 'HILQHRUGHVFULEHWKHVHJPHQWRIWKH SRSXODWLRQLQ1HZSRUW%HDFKWKDW\RXLQWHQGWR VHUYHE\\RXUSURMHFWSURJUDP,QFOXGHVXFK WKLQJVDVDJHORFDWLRQQXPEHUVVHUYHGHWF 'DQFH([SUHVVLRQVZLOOVHUYHVWXGHQWV JUDGHVDJHVIURP&G0%%DQG 1++6DQGDGGLWLRQDOVWXGHQWVIURP1HZSRUW %HDFKEDVHGVFKRROVWHDFKHUVDGPLQLVWUDWRUV DVZHOODVDXGLHQFHPHPEHUVIURPWKH 1HZSRUW%HDFKFRPPXQLW\DWWHQGLQJWKH)DOO 6KRZFDVHDW&G00RVWVWXGHQWVKDYHKDGOLWWOH WRQRLQYROYHPHQWZLWKDSURIHVVLRQDOGDQFH FRPSDQ\RUKDGWKHRSSRUWXQLW\WRVHHD FRQWHPSRUDU\PRGHUQGDQFHSHUIRUPDQFHLQ 1HZSRUW%HDFK7KHH[SHULHQFHZLOOHQJDJH VWXGHQWVಬFULWLFDOWKLQNLQJDELOLWLHVDQG LPDJLQDWLRQVLQDVDIHHQYLURQPHQWZKLOHWKH\ GHYHORSQHZDUWLVWLFVNLOOVWREDODQFHWKHLU DFDGHPLFDQGVRFLRHPRWLRQDOVWUHVVRUV %DFNKDXVGDQFHSURIHVVLRQDOWHDFKLQJDUWLVWVDUH VNLOOHGDWZRUNLQJZLWKVWXGHQWVRIDOODELOLWLHVWR HQJDJHDGLYHUVHUDQJHRIDJHVVNLOOOHYHOVDQG EDFNJURXQGV 352-(&7%8'*(7([SHQVHV3HUVRQQHO 10 of 23 41 $$UWLVWLF )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV $GPLQLVWUDWLYH )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 7HFKQLFDO3URGXFWLRQ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 352-(&7%8'*(7([SHQVHV2SHUDWLQJ )DFLOLW\([SHQVH6SDFH5HQWDO )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 0DUNHWLQJ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 3URGXFWLRQ([KLELWLRQ([SHQVH )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 7RXULQJ3UHVHQWDWLRQ([SHQVH )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV (GXFDWLRQ0DWHULDOV )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 7UDQVSRUWDWLRQ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK 11 of 23 42 ))XQGLQJIURP2WKHU6RXUFHV (TXLSPHQW )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 2WKHULIJUHDWHUWKDQDQQRWDWHEHORZ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV *5$1'727$/JUDQWIXQGLQJUHTXHVW 'DQFH([SUHVVLRQV&UHDWLYLW\DQG &KRUHRJUDSK\DOLJQVZLWK&DOLIRUQLD'HSDUWPHQW RI(GXFDWLRQVWDQGDUGVIRU'DQFH3K\VLFDO (GXFDWLRQ8QLYHUVDO'HVLJQIRU/HDUQLQJ8'/ DQG6RFLDO(PRWLRQDO/HDUQLQJ6(/$GGLWLRQDO UHODWHGDFDGHPLFDUHDVLQFOXGH(QJOLVK /DQJXDJH$UWV6FLHQFH3K\VLFDOVDQG0DWK +LVWRU\6RFLDO6FLHQFHV ([SHFWHGRXWFRPHVLQFOXGH 6NLOO'HYHORSPHQWRISDUWLFLSDQWVZLOO GHPRQVWUDWHOHDUQLQJDQGUHWHQWLRQRI FRQWHPSRUDU\GDQFHWHFKQLTXHLQFOXGLQJ PRYHPHQWYRFDEXODU\LPSURYLVDWLRQ FKRUHRJUDSK\DQGWHDPZRUN (QJDJHPHQWDQG,QVSLUDWLRQRI SDUWLFLSDQWVZLOOUHSRUWLQFUHDVHGVHOIFRQILGHQFH KDYLQJIXQDQGEHLQJDEOHWRH[SUHVV WKHPVHOYHVLPSURYLQJVRFLDOFRQQHFWLRQZHOO EHLQJFUHDWLYLW\DSSUHFLDWLRQIRUGDQFHDVDQDUW IRUPDQGQHZDZDUHQHVVRIFROOHJHDQGFDUHHU RSSRUWXQLWLHV 3URJUDPHYDOXDWLRQLQFOXGHVTXDQWLWDWLYHDQG TXDOLWDWLYHPHWKRGVWRDVVHVVWKHUHVLGHQF\ V DFFRPSOLVKPHQWVDQGVLJQLILFDQFHSURYLGLQJ RYHUKRXUVRILQVWUXFWLRQWRDSSUR[LPDWHO\ PLGGOHDQGKLJKVFKRROVWXGHQWVDQG 'HVFULEHWKHH[SHFWHGTXDQWLILDEOHRXWFRPHV RI\RXUSURMHFWSURJUDPDQGKRZ\RXZLOO HYDOXDWHWKHUHVXOWV%HYHU\VSHFLILFLQ DGGUHVVLQJWKHZD\VWKDW\RXZLOOGHWHUPLQHWKDW \RXUSURMHFWSURJUDPPHWWKHQHHGVWKDW\RX LGHQWLILHGDQGDFFRPSOLVKHVWKHJRDOV\RXVHWRXW WRDFKLHYHLH\RXSURYLGHKRXUVRIPXVLFDO LQVWUXFWLRQDQGLQVWUXPHQWVWRWKHFKLOGUHQDW 1HZSRUW(OHPHQWDU\VFKRRODVPHDVXUHGE\ PXVLFVWRUHUHQWDOUHFHLSWVDQGORJVRI LQVWUXFWRUV 12 of 23 43 SHUIRUPDQFHVWRDQDGGLWLRQDOVWXGHQWV 7RROVLQFOXGHGDLO\DWWHQGDQFHRQOLQHSUHDQG SRVWVXUYH\VUHIOHFWLYHGLVFXVVLRQVDQGVWXGHQW HVVD\VWRPHDVXUHJURZWKLQWHFKQLFDOVNLOOV FUHDWLYLW\WHDPZRUNFRQILGHQFHDQGWKHMR\RI OHDUQLQJDQGSHUIRUPLQJ)HHGEDFNIURP VWXGHQWVHGXFDWRUVDGPLQLVWUDWRUVDQGSDUHQWV ZLOODOVRUHIOHFWWKHRYHUDOOLPSDFWRIVHHLQJD JUHDWHUDSSUHFLDWLRQIRUGDQFHDVDQDUWIRUPDQG DSRVVLEOHFDUHHUSDWKZD\ 7HDFKLQJDUWLVWVUHFRUGGDLO\QRWHVWRWUDFN SURJUHVVDQGPDNHUHILQHPHQWVDVQHHGHG$Q DUWLVWLFDQGHGXFDWLRQDOWHDPFRQVLVWLQJRI -HQQLIHU %DFNKDXV$PDQGD.D\:KLWHDVVRFLDWH DUWLVWLFGLUHFWRU1DQF\:DU]HU%UDG\DOVRD 1HZSRUW%HDFKUHVLGHQWDQG&KLKLUR6DQR FRPSDQ\GDQFHUVDQG(GXFDWLRQ&RRUGLQDWRU FROODERUDWHFORVHO\ZLWK&G0%%DQG1++6 HGXFDWRUVDORQJZLWK7DPDUD)DLUEDQNV1086' YLVXDODQGSHUIRUPLQJDUWVFRRUGLQDWRUWRSODQ DQGHQVXUHWKHSURJUDP VVXFFHVV1DQF\ :DU]HU%UDG\FRRUGLQDWHVWKHUHVLGHQF\ RYHUVHHVFXUULFXOXPFRQWHQWPDQDJHVGDQFHUV WHDFKLQJDUWLVWVZRUNVKRSVDQGSHUIRUPDQFHV SURPRWLQJDQGUHLQIRUFLQJVWURQJFRPPXQLW\ HQJDJHPHQWDQGWKHFXOWXUDOEHQHILWWRWKH&LW\RI 1HZSRUW%HDFK //LVWRI%RDUG0HPEHUVDQGWKHLUDIILOLDWLRQV 5HFHQWOLVWRILQGLYLGXDOVFRUSRUDWLRQVDQG IRXQGDWLRQVWKDWSURYLGHRUJDQL]DWLRQDOVXSSRUW ,56'HWHUPLQDWLRQ/HWWHULI\RXDUHD FbLQGLFDWLQJWD[H[HPSWVWDWXV 13 of 23 Document found on page 16. Document found on page 17. Document found on pages 18-21. 44 22QHEURFKXUHDQGRURQHSUHVVFOLSSLQJ , ,QFRPHFDVKRQO\ &RQWULEXWHG )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG (DUQHG )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 7RWDO,QFRPH )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG ,, ([SHQVHV 3URJUDP )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG *HQHUDODQG$GPLQLVWUDWLYH )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 0DUNHWLQJDQG'HYHORSPHQW )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 7RWDO([SHQVHV )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG ,WHP ,,, 2SHUDWLQJ6XUSOXV'HILFLW,QFRPHPLQXV([SHQVHV 14 of 23 Document found on pages 22-23. 45 ))<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG ,9 )XQGG%DODQFHHDWW%HJLQQLQJJRII<HDU )<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG 9 $FFXPXODWHGG6XUSOXVV'HILFLW$GGGOLQHVV,,,,DQGG,9 )<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG ,WHPP 9, ,Q.LQGG&RQWULEXWLRQVVDWWDFKKVFKHGXOHVVLIIJUHDWHUUWKDQQRIIWRWDOOLQFRPH )<<%XGJHWWFXUUHQWQD )<<%XGJHWWSURMHFWHGQD ,,YHULI\\WKHHNQRZOHGJHHWKDWWWKHHLQIRUPDWLRQQ VXEPLWWHGGLQQWKLVVDSSOLFDWLRQQLVVWUXHHDQGGFRUUHFWWWRR WKHHEHVWWRIIP\\NQRZOHGJH 1DPH 1DQF\:DU]HU%UDG\ 7LWOH 'LUHFWRURI(GXFDWLRQDQG&RPPXQLW\ (QJDJHPHQW /DVWW8SGDWH 6WDUWW7LPH )LQLVKK7LPH 3RZHUHGE\)RUPVLWH15 of 23 46 Board of Directors, 2025-2028 Mike Kerr, Chairman Real Estate Developer, President, Terranet Leona Aronoff-Sadacca Arts & Community Philanthropist Christopher Blank Attorney Sue and Jim Colombo Real Estate Joann Leatherby Arts & Community Philanthropist Benny Mor Corporate/Retail Cyrus Parker-Jeannette Dean Emerita, College of the Arts, California State University at Long Beach Alex Stimpson The Gerrit and Amy Cole Foundation Valerie Van de Zilver Real Estate Judy Whitmore Performer, Arts Philanthropist Backhausdance photography by Sarah Delgado on location in the Back Bay, Newport Beach. P.O. Box 5890, Orange, CA 92863 | 949.751.7874| https://www.backhausdance.org/ 16 of 23 47 Cultural Arts Grant - Newport Beach City Arts Commission 2025-2026 Organizational Support: Individuals, Corporation, Foundation, Government, 2024-2025 Karen Adnams Karen Akashi Susan Anderson David Applebaum Leona Aronoff-Sadacca Jennifer Backhaus Paul Baez Anastasia Bartoli Robert Becker Jay Berger Jeannie Berryman Chris Blank and Josie Badeaux Kimberley Blank Craig Boardman Margaret Bodeau Jennifer Bonfil Rick Boxeth Alexander Brana Ellen Breitman Lorianne Bundnick Susan Casabella Jim Cigler Joe Cisneros City of Costa Mesa City of Newport Beach City of Santa Ana Sue and Jim Colombo Cyrille Conseil Claudia Contreras Roberta "Bobbi" Cox Jackie D’Ambrosio Laura and Matt Day Liz Drolet Eugenia Esgalhado Gary Fabian Farmers & Merchant Bank Foundation Robert Farnsworth Ralph & Lorraine Fish Barbara Foster Marianne Gastelum Kristina Goodfellow Ethan Gregory Lindsey Hager Clara Harnett Marc & Justin Harvey Eddie Herbert Jesse Hoggard Judi Imm Karou Iwata Marica Pendjer and John Miller Debbie Johnson Judy Joss Samuel Kelaher Bert Kelley Bentley & Mercedes Kerr Mike Kerr Debra Kerr-Orlick Jen and Jason Krupoff Joann Leatherby David Lewis Mary & Gary Lisenbee Genevieve and Matthew Macias Liz Maxwell Pat McAuley Dale Merrill Benny Mor Lori Murphy Kimberly Olmos Michael Olmos Giulio and Cheryl Ongaro Orange County Community Foundation Cyrus and Patrick Parker-Jeannette Dick Paulsen Sandy Pedersen Nemie Pollack Charles Rayfield Michael Regan Ghada Riad Liliana Rodriguez Robert Romney Ginny Rooney Martha Ryan Tony and Tricia Sanchez Verylann Selby Sharron Shepard Sarah Shirley Jerry & Karen Southards Nancy & Rob Stewart The Gerrit and Amy Cole Foundation Kajsa Thuresson-Frary Chris and Delia Trela Bart van Aardenne Valerie and Peter Van de Zilver Jeff Verdon Nancy Warzer-Brady Sandra Waugh Suzanne Wessman Patty & Tom West W. Raymond White Judy and Wes Whitmore Lori Zucchino 17 of 23 48 18 of 23 49 19 of 23 50 20 of 23 51 21 of 23 52 22 of 23 53 23 of 23 54 &&XOWXUDO$UWV*UDQWV$SSOLFDWLRQ)RUP 5HIHUHQFH 6WDWXV &RPSOHWH /RJLQ8VHUQDPH ]HQHGZDUGV#LFORXGFRP /RJLQ(PDLO ]HQHGZDUGV#LFORXGFRP 3RSXODU1DPHRI2UJDQL]DWLRQ %DURTXH0XVLF)HVWLYDO&RURQDGHO0DU /HJDO1DPHLIGLIIHUHQW%DURTXH0XVLF)HVWLYDO&RURQDGHO0DU )HGHUDO7D[,'1R 0DLOLQJ$GGUHVV 32%R[ &LW\=LSFRGH &RURQDGHO0DU &RQWDFW1DPH =HQ(GZDUGV 3KRQHQXPEHU (PDLODGGUHVV ]HQHGZDUGV#LFORXGFRP :HEVLWH KWWSVEPIFGPRUJ *HRJUDSKLFDO$UHD6HUYHG 3ULPDULO\&RURQDGHO0DU1HZSRUW%HDFKRWKHU 2UDQJH&RXQW\FLWLHVDQGJUHDWHU6RXWKHUQ &DOLIRUQLD +DYH\RXUHFHLYHGD&LW\RI1HZSRUW%HDFK &XOWXUDO$UWV*UDQWEHIRUH" <HV ,IVRZKDW\HDUGLG\RXUHFHLYHDJUDQW" <HDURUJDQL]DWLRQZDVIRXQGHG 1XPEHURISDLGVWDIISDUWWLPH 1XPEHURIDFWLYHYROXQWHHUV 7RWDODPRXQWUHTXHVWHGIURPUHTXHVWOLQHRI SURMHFWEXGJHW (VWLPDWHGQXPEHURISHRSOHLQ1HZSRUW%HDFK WKDWWKHSURSRVHGSURMHFWVZLOOVHUYH 1 of 17 ATTACHMENT B 55 7KHPLVVLRQRIWKH%DURTXH0XVLF)HVWLYDO &RURQDGHO0DU%0)LVWRSUHVHQWKLJKOHYHO SURIHVVLRQDOFRQFHUWVWKDWSURPRWHWKHEHDXW\ DQGYDULHW\RI%DURTXHPXVLFDWDIIRUGDEOHSULFHV LQLQWLPDWHORFDOYHQXHVZLWKHGXFDWLRQDO DVSHFWV7KH%0)KDVKHOGDVHULHVRIFRQFHUWV LQ-XQHIRU\HDUVDW6KHUPDQ*DUGHQVDQGLQ DFRXVWLFDOO\DSSURSULDWHORFDOFKXUFKHV,Q WKH%0)UHFHLYHGLWVKLJKHVWWLFNHWVDOHVLQWKH RUJDQL]DWLRQಬVKLVWRU\IRULWV9LYDOGLWKHPHG )HVWLYDO%XLOGLQJRQWKLVPRPHQWXP%0)ಬV JRDOVIRUDUHWRHQJDJHDODUJHUQXPEHURI PXVLFLDQVWRH[SDQGUHSHUWRLUHFKRLFHVFRQWLQXH DXGLHQFHDQGVXSSRUWHUJURZWKDQGWRGHHSHQ FRPPXQLW\HQJDJHPHQW7KHVXFFHVVIXOVXPPHU FRQFHUWVHULHVPRGHOHVWDEOLVKHGE\3URI%XUWRQ .DUVRQLQDQGFDUULHGRQE\WKH)HVWLYDOಬV QGDUWLVWLFGLUHFWRU(OL]DEHWK%OXPHQVWRFN VLQFHZLOOFRQWLQXHWRVXVWDLQDQGGHYHORS FRPPXQLW\FRQQHFWLRQVWKURXJK%DURTXHPXVLF 7KH%XUWRQ.DUVRQ0XVLF(GXFDWLRQ)XQGDQG 3URJUDPHVWDEOLVKHG-XQHWRSULPDULO\IXQG RQFDPSXVZRUNVKRSVDQGRWKHULQWHUDFWLYH DFWLYLWLHVKHOGZKLOHVFKRROVDUHLQVHVVLRQKDG LWVILUVWIUHHHYHQWLQ2FWREHURQWKHFDPSXV RI6W0LFKDHODQG$OO$QJHOV&RURQDGHO0DU RSHQLQJWKHH\HVDQGHDUVRIFRPPXQLW\ PHPEHUVDJHVWRWR%DURTXHFKDPEHU PXVLFLWVUHOHYDQFHDQGLWVVRFLRKLVWRULF FRQWH[WDQGUDLVLQJDZDUHQHVVRIWKH%0)ಬV PDLQVWDJHFRQFHUWV7KH)HVWLYDO-XQH RIIHUVDPXVLFDOWRXUDURXQG(XURSHLQKRQRU RIPXVLFಬVSDWURQVDLQW6W&HFLOLD7KHPDLQ FRQFHUWIRUWKLVDSSOLFDWLRQLVWKH)LQDOHRQ-XQH IHDWXULQJWKH)HVWLYDO2UFKHVWUDYRFDO VRORLVWVDQGYRLFHGFKRUXVFRQFOXGLQJWKLV \HDUಬVVHULHVWLWOHGಯ%ULJKW&HFLOLD7KH3RZHURI +DUPRQ\ರ7KHSURJUDPLQFOXGHV+DQGHOಬVODUJH %ULHIO\GHVFULEHEHORZ\RXURUJDQL]DWLRQ V SXUSRVHPLVVLRQDQGJRDOV 2 of 17 56 VFDOHಯ2GHIRU6W&HFLOLDಬV 'D\ರ:HZLOOSURPRWH6WXGHQWV*RIRU %DURTXH5XVK7LFNHWVIRUWRORFDOVWXGHQWV IRUDOOFRQFHUWVZLWKJHQHUDODGPLVVLRQSULFHV DYHUDJLQJDQLQFUHDVHGHDFKXSGXHWR ULVLQJFRVWV 7KH%0)LVVWLOOWKHRQO\SURIHVVLRQDOH[FOXVLYHO\ FODVVLFDOPXVLFSUHVHQWHUKHDGTXDUWHUHGLQ 1HZSRUW%HDFK&RURQDGHO0DUDQGRXUZRUN FRQWLQXHVWREXLOGRQRXUORQJVWDQGLQJWUDFN UHFRUGRIVHUYLQJWKHORFDOFRPPXQLW\:LWK FRQFHUWVKHOGLQ&RURQDGHO0DUDQG1HZSRUW %HDFKWKH%0)LVFRPPLWWHGWRSURYLGLQJ SHUIRUPDQFHVDQGQRZHGXFDWLRQHYHQWVWKDWDUH DUWLVWLFDOO\RXWVWDQGLQJHQMR\DEOHDQGIXOO\ DFFHVVLEOHWRDORFDODXGLHQFHRIDOODJHV:H LQFOXGHFRQVLGHUDWLRQRISK\VLFDODFFHVV JHRJUDSKLFVHQULFKPHQWHGXFDWLRQDQGFRVWDV ZHOODVಯOHDQರRSHUDWLQJH[SHQVHVZKLOHKROGLQJ RXUVHOYHVPXVLFLDQVDQGVHDVRQDOVWDIIWRKLJK SXEOLFVWDQGDUGV&RQFHUWDWWHQGHHVDUHSURYLGHG ZLWKVXUYH\VDQGDWWKH)HVWLYDOWKH UHWXUQHGZHUHKLJKO\VXSSRUWLYHZLWKYRWHV RIಯ([FHOOHQWರRQSHUIRUPDQFHVಯ([FHOOHQWರ RQRYHUDOOH[SHULHQFHUHVSRQVHVಯJRRGರ OHIWEODQNDQGಯ<HVರWRUHFRPPHQGLQJWRD IULHQGIURPRIUHVSRQGHHVRI UHVSRQVHVZHUHIURPQHZFRPHUVIURP WKRVHDWWHQGLQJ\HDUVDQGIURPORQJ WLPHUV7KH%0)UHPDLQVDFRQVLVWHQWO\SRSXODU HYHQWWKLVSDVW\HDUZLWKVROGRXWFRQFHUWVDQG ZHUHFORVHWRFDSDFLW\2XUDXGLHQFHVDUH PDLQO\UHVLGHQWVIURPWKHLPPHGLDWH1HZSRUW %HDFKDUHDDQGQHDUE\FRPPXQLWLHV7LFNHW VDOHVLQZHUHPXFKKLJKHUWKDQUHFHQW \HDUVDQGQHDUO\RYHUWDUJHWGXHWR 9LYDOGLಬVSRSXODULW\:HKDGDUHFRUGILUVW ,GHQWLI\DQGGHVFULEHZK\WKHUHLVDQHHGLQ WKH1HZSRUW%HDFK&RPPXQLW\IRU\RXU SURSRVHGSURMHFWSURJUDP,QFOXGHDTXDQWLWDWLYH GHVFULSWLRQRIWKHQHHGDQGRQZKDW\RXEDVHG \RXUILQGLQJVLHಯ%DVHGRQDVWXG\GRQHE\WKH 37$WKHUHDUHRQHKXQGUHGFKLOGUHQLQWKHWK WKJUDGHVDW1HZSRUW(OHPHQWDU\ZKRKDYHKDG QRWUDLQLQJZLWKPXVLFDOLQVWUXPHQWVರ'HVFULEH KRZ\RXKDYHGHWHUPLQHGWKDW\RXURUJDQL]DWLRQ LVWKHEHVWRUJDQL]DWLRQIRUWKHSURSRVHGSURMHFW SURJUDP 3 of 17 57 WLPHEX\HUVFRPSDUHGWRLQDQG LQ7KLVERRVWXQGHUVFRUHVWKHLPSRUWDQFH RIRXURXWUHDFKHIIRUWVHDFK\HDUDVZHOODV VDYY\SURJUDPPLQJDVHYHQORQJWLPHUHVLGHQWV FRQWLQXHWRGLVFRYHUWKH%0)6XVWDLQLQJDQG GHYHORSLQJRXWUHDFKZRUNFRQWLQXHVDVDSULRULW\ 2XU*DODLVLQHDUO\0DUFKDJDLQWKLV\HDU UDWKHUWKDQ-DQ)HEDVLQWKHSDVWDVZH FRQWLQXHWRRSWLPL]H HQJDJHPHQWIURPQHZFRPHUVDQGUHJXODUV 7KH)LQDOHZLOOSUHVHQWPXVLFE\WKH*HUPDQ (QJOLVKFRPSRVHURI0HVVLDK*HRUJH)ULGHULF +DQGHOದRQHRI%DURTXHPXVLF V ಯMXJJHUQDXWVರDORQJVLGH%DFKDQG9LYDOGL ,QWHUQDWLRQDOO\UHFRJQLVHGDQGDFWLYHVRSUDQR DQGWHQRUVRORLVWVEDVHGRXWVLGH&DOLIRUQLDMRLQ WKH)HVWLYDO2UFKHVWUDLQLWVODUJHVWIRUPDWLRQ VLQFHSUH&29,'WLPHVDQGDQSLHFHFKRLURI ORFDODUHDEDVHGVLQJHUVDOOOHGE\%OXPHQVWRFN IURPWKHYLROLQ%RWKVRORLVWVPDNHWKHLU)HVWLYDO GHEXWVWKH3KLODGHOSKLDEDVHGVRSUDQR+DQQDK 'H3ULHVWLVGHVFULEHGDVDಯVWDQGRXWರDQG SUDLVHGIRUKHUಯEULJKWLGHDOO\IRFXVHGVRXQG DOOLHGWRDSURELQJH[SUHVVLYHLQWHOOLJHQFHರ &KLFDJR&ODVVLFDO5HYLHZ7KHಯOXPLQRXVರ %RVWRQ*OREH\RXQJVRSUDQRHQMR\VDIDVW ULVLQJFDUHHULQ1RUWK$PHULFDDQG(XURSH0XFK VRXJKWDIWHUO\ULFWHQRU1LFKRODV3KDQHQMR\VD ZHOOHVWDEOLVKHGLQWHUQDWLRQDOFDUHHU+HZRQWKH *UDPP\$ZDUGIRU%HVW2SHUD5HFRUGLQJ IRUKLVUHFRUGLQJRI.DLMD6DDULDKRಬV$GULDQD 0DWHUZLWK(VD3HNND6DORQHQDQGWKH6DQ )UDQFLVFR6\PSKRQ\+LVDOEXP$&KDQJH,V *RQQD&RPHZDVQRPLQDWHGIRUWKH *UDPP\$ZDUGIRU%HVW&ODVVLFDO6ROR9RFDO $OEXP:LWKDSUHYLRXVDOEXPLQKHZDV WKHILUVWVLQJHURI$VLDQGHVFHQWWREHQRPLQDWHG 'HVFULEHWKHVSHFLILFSURMHFWSURJUDPWKDWZLOO EHIXQGHGE\DFXOWXUDOJUDQW,QFOXGHKRZWKH SURSRVHGSURMHFWSURJUDPZLOOEHLPSOHPHQWHG DQGRXWOLQHDVFKHGXOHRUSURMHFWWLPHOLQHZLWK SODQQHGGDWHVDQGORFDWLRQV,GHQWLI\LQGLYLGXDOV DQGJURXSVLQYROYHGSDUWLFXODUO\DUWLVWVDQG SHUIRUPHUVDQGGHVFULEHWKHLUUROHVDQG UHVSRQVLELOLWLHV'HVFULEHWKHEDFNJURXQGDQG TXDOLILFDWLRQVRI\RXURUJDQL]DWLRQDQGNH\ SHUVRQQHOWREHLQYROYHGLQWKHSURJUDP 5HPHPEHUWKH&LW\IXQGVRQO\SURMHFWVDQG SURJUDPVQRWRSHUDWLQJH[SHQVHV7KHVH SURMHFWVDQGSURJUDPVPXVWSURPRWHFRPPXQLW\ LQYROYHPHQWDQGDZDUHQHVVRIWKHDUWVLQ 1HZSRUW%HDFK 4 of 17 58 LQWKHKLVWRU\RIWKH%HVW&ODVVLFDO6ROR9RFDO $OEXPFDWHJRU\DZDUGHGE\WKH5HFRUGLQJ $FDGHP\VLQFH7KHSURSRVHG1%$&JUDQW ZRXOGVXSSRUWIHHVDQGWUDYHOIRUWKHVHWZR VRORLVWVWRWDOFRPELQHGFRVWaDQG FRQWULEXWHWRIHHVDQGORFDOWUDYHOIRUWKHHLJKW /$EDVHGVLQJHUV)XQGVZLOODOVRVXEVLGL]H VWXGHQWUXVKWLFNHWVIRUDOOFRQFHUWVDQGKHOS FRYHUFRVWVWRSURPRWHHGXFDWLRQDODVSHFWVUXVK WLFNHWVRSHQGUHVVUHKHDUVDOVDQGQHZWKLV \HDUD%DURTXHಯರV\PSRVLXPIRUORFDOPXVLF HGXFDWRUVVWXGHQWV)HVWLYDOVXEVFULEHUVDQG FXUUHQWGRQRUV RQ6DWXUGD\-XQHDIWHUDQLQYLWDWLRQWR DWWHQGRXURSHQLQJFRQFHUWGUHVVUHKHDUVDO 5XVKWLFNHWVZLOODJDLQEHDYDLODEOHWR1086' VWXGHQWVಬIDPLO\PHPEHUVDVZHOODVWKHVWXGHQWV WKH\DUHDFFRPSDQ\LQJ*UDQWPRQLHVZLOOKHOS IXQGLQYLWDWLRQVIRUPLGGOHVFKRROKLJKVFKRRO DQGFROOHJHVWXGHQWVIURP1HZSRUW%HDFKDQG QHDUE\WRDWWHQGGUHVVUHKHDUVDOVRQ-XQH DQG7KHVHEHKLQGWKHVFHQHVRSSRUWXQLWLHV RIIHUDXQLTXHJOLPSVHLQWRWKHGHWDLOHGUHKHDUVDO SURFHVVIURPWKHPXVLFLDQV SHUVSHFWLYH 6WXGHQWVDVNTXHVWLRQVH[SORUHWKHLQVWUXPHQWV DQGXQGHUVWDQGKRZWKHFRPSRVHUVWKHPVHOYHV KHDUGWKLVPXVLFEHIRUHDWWHQGLQJWKHIRUPDO FRQFHUWWKHQH[WGD\LIWKHLUVFKHGXOHDOORZV7KH QHZLQLWLDWLYHRIWKH%DURTXH6\PSRVLXP RQ6DWXUGD\-XQHIROORZLQJWKHGUHVV UHKHDUVDOZLOOEHMRLQWO\IXQGHGE\WKH%XUWRQ .DUVRQ0XVLF(GXFDWLRQ)XQGWKH)HVWLYDO EXGJHWDQGSRWHQWLDOO\DSRUWLRQRIWKLVJUDQW &RVWVLQYROYHGLQFOXGHYHQXHUHQWDOPRGHVW UHIUHVKPHQWVDQGRXU(GXFDWLRQ3URJUDP 'LUHFWRU'U/LQGVH\6WUDQG3RO\DNಬVWLPH SUHSDULQJDQGJLYLQJWKHSUHVHQWDWLRQSOXV%0) VWDIIWLPHWRSURPRWHWKHHYHQWZKLFKZLOOEH 5 of 17 59 PDUNHWHGWRPXVLFHGXFDWRUVYLDRXUGHFDGHV ORQJDVVRFLDWLRQZLWK&DO6WDWH)XOOHUWRQPXVLF GHSDUWPHQWಬV)UDWHUQLW\6LQIRQLDDOXPQLDQGYLD 1086'DQGRWKHUORFDOHGXFDWLRQSDUWQHUV ,QYLWDWLRQVZLOODOVREHH[WHQGHGWR)HVWLYDO VXEVFULEHUVDQGGRQRUVLQOLQHZLWKRXUJRDOWR GHHSHQVXSSRUWHUH[SHULHQFHVDQGLQYHVWPHQW 0DQ\RQO\DWWHQGWKHVH%DURTXHFRQFHUWVLQD RQFHD\HDUF\FOHDQGGHVSLWH%OXPHQVWRFNಬV FRPSUHKHQVLYHDQGHQWHUWDLQLQJSURJUDPQRWHV DQGVSRNHQFRQFHUWUHPDUNVKDYHTXHVWLRQV DERXW%DURTXHಯEDVLFVರDVZLWQHVVHGDWRXUPRVW UHFHQW)DOO3UHYLHZLQ2FWREHU,QFRQWH[W WKHFRPSOHWHVFKHGXOHLQFOXGHV-XQH RSHQGUHVVUHKHDUVDOVVWXGHQWVHGXFDWRUV NH\VXSSRUWHUV-XQH%DURTXH 6\PSRVLXP-XQHಯ3DULVLDQ3OHDVXUHVರDW6W 0DUN3UHVE\WHULDQ1HZSRUW%HDFK)HVWLYDO 2UFKHVWUDGLU%OXPHQVWRFNLQD9LYDOGL LQIOXHQFHG/HFODLU9LROLQ&RQFHUWRDQGGUDPDWLF VXLWHVE\0DUDLV5HEHODQG5DPHDX-XQH ಯ$&¸WKHQ&KDPEHU%DFK6RQDWDVರDW6W 0LFKDHO $OO$QJHOV&RURQDGHO0DU %OXPHQVWRFN KDUSVLFKRUGLVWDQGRUJDQLVW 0DWWKHZ'LUVW-XQHಯ&RQFHUWLGಬ,WDOLDರDW 6KHUPDQ/LEUDU\ *DUGHQVUHFRUGHUDQGVWULQJ FRQFHUWRVE\9LYDOGL'XUDQWHDQGRWKHUV-XQH ಯ$6SDQLVK6DOµQ&KDPEHU0XVLF1LJKWರDW 6W0DUN1HZSRUW%HDFK%RFFKHULQLಬV/D5LWLUDWD GL0DGULGDQGಯ)DQGDQJRರTXLQWHWVIRUJXLWDUDQG VWULQJVDQG6SDQLVKVRORJXLWDUPXVLFDQG-XQH DW6W0DUN3UHVE\WHULDQಯ)HVWLYDO)LQDOH6W &HFLOLDಬV'D\ರ ,,VWKLVDQHZRUH[LVWLQJSURMHFWSURJUDP"1HZSURJUDP 'HILQHRUGHVFULEHWKHVHJPHQWRIWKH SRSXODWLRQLQ1HZSRUW%HDFKWKDW\RXLQWHQGWR :KLOH)HVWLYDODWWHQGHHVJHQHUDOO\VNHZWRORFDO DQGQHDUE\DUHDUHVLGHQWVLQWKHDJH 6 of 17 60 VVHUYHE\\RXUSURMHFWSURJUDP,QFOXGHVXFK WKLQJVDVDJHORFDWLRQQXPEHUVVHUYHGHWF UDQJHRWKHUJURXSVDUHUHSUHVHQWHGLQFOXGLQJ IDPLOLHVDQGORFDOVWXGHQWV$SSUR[LPDWHO\ RIRXUPDLOLQJOLVWRIaUHVLGHVLQWKH RU]LSFRGHV7KHVHORFDO VXSSRUWHUVUHSUHVHQWHGRI)HVWLYDOEX\HUVLQ FRPSDUHGWRLQDQGLQ 7KHSRSXODULW\RI9LYDOGLDQGಯ7KH)RXU 6HDVRQVರEURXJKWPRUHSHRSOHLQWRWKH&LW\RI 1HZSRUW%HDFKIRUWKLV\HDUಬVFRQFHUWVOLNHO\ EHQHILWLQJWKHFLWLHVಬUHVWDXUDQWVDQGRWKHU DPHQLWLHV 352-(&7%8'*(7([SHQVHV3HUVRQQHO $UWLVWLF )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV $GPLQLVWUDWLYH )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 7HFKQLFDO3URGXFWLRQ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 352-(&7%8'*(7([SHQVHV2SHUDWLQJ )DFLOLW\([SHQVH6SDFH5HQWDO )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 0DUNHWLQJ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 3URGXFWLRQ([KLELWLRQ([SHQVH )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK 7 of 17 61 ))XQGLQJIURP2WKHU6RXUFHV 7RXULQJ3UHVHQWDWLRQ([SHQVH )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV (GXFDWLRQ0DWHULDOV )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 7UDQVSRUWDWLRQ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV (TXLSPHQW )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 2WKHULIJUHDWHUWKDQDQQRWDWHEHORZ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV *5$1'727$/ 7KH)HVWLYDOZLOOKRVWILYHFRQFHUWV-XQHDW 6KHUPDQ/LEUDU\ *DUGHQVDQGLQORFDO FKXUFKHV%HIRUHHDFKFRQFHUWRXURXWGRRU EUDVVTXLQWHWZLOOSOD\WRZHOFRPHJXHVWVDQG HQKDQFHWKHFRQFHUWJRLQJH[SHULHQFHDORQJ ZLWKSUHFRQFHUWFRQFHVVLRQVDW6KHUPDQ *DUGHQV,QWRWDO)HVWLYDOPXVLFLDQVZLOOSHUIRUP RYHUKRXUVRIPXVLF:HZLOOYHULI\WKLVE\ DXGLWLQJFRQFHUWVWDUWDQGHQGWLPHVIDFWRULQJLQ LQWHUPLVVLRQV2YHUWKHHLJKWGD\VWKH)HVWLYDO ZLOOHPSOR\PXVLFLDQVLQFOXGLQJ%DURTXH VSHFLDOLVWYRFDOLVWVRUFKHVWUDOSOD\HUVDQGRWKHU SURIHVVLRQDOV3D\UROOUHFRUGVZLOOGRFXPHQW PXVLFLDQHPSOR\PHQWQXPEHUV7KHSURJUDPZLOO 'HVFULEHWKHH[SHFWHGTXDQWLILDEOHRXWFRPHV RI\RXUSURMHFWSURJUDPDQGKRZ\RXZLOO HYDOXDWHWKHUHVXOWV%HYHU\VSHFLILFLQ DGGUHVVLQJWKHZD\VWKDW\RXZLOOGHWHUPLQHWKDW \RXUSURMHFWSURJUDPPHWWKHQHHGVWKDW\RX LGHQWLILHGDQGDFFRPSOLVKHVWKHJRDOV\RXVHWRXW WRDFKLHYHLH\RXSURYLGHKRXUVRIPXVLFDO LQVWUXFWLRQDQGLQVWUXPHQWVWRWKHFKLOGUHQDW 1HZSRUW(OHPHQWDU\VFKRRODVPHDVXUHGE\ PXVLFVWRUHUHQWDOUHFHLSWVDQGORJVRI LQVWUXFWRUV 8 of 17 62 FRQVLVWSULPDULO\RI%DURTXHHUDPXVLFFKRVHQE\ (OL]DEHWK%OXPHQVWRFN$&XOWXUDO$UWV*UDQWZLOO VLJQLILFDQWO\KHOSZLWKKLJK)LQDOHVRORLVW H[SHQVHVVXSSRUWRXUILUVW%DURTXHV\PSRVLXP RQ-XQHDQGDVVLVWLQWKHUROORXWRI )HVWLYDOVWXGHQWRSSRUWXQLWLHV7LFNHWVDOHVRQO\ FRYHUHGRIGLUHFW)HVWLYDOFRVWVDJDLQLQ GXHWRULVLQJFRVWVLQFOXGLQJPXVLFLDQVಬ IHHV$PHULFDQ)HGHUDWLRQRI0XVLFLDQV &ROOHFWLYH%DUJDLQLQJ$JUHHPHQWYHQXHUHQWDOV PXVLFLDQVಬDLUIDUHVDQGFDWHULQJIRUSDWURQVDQG PXVLFLDQV$VDOZD\VRXUREMHFWLYHLVWRSURYLGH WKHORFDOFRPPXQLW\DQGSHRSOHIURPWKH VXUURXQGLQJDUHDZLWKDVHULHVRIKLJKTXDOLW\ %DURTXHSHUIRUPDQFHVZLWKHGXFDWLRQDO FRPSRQHQWV:HZLOODVVHVVDXGLHQFHDSSURYDO UDWLQJVXVLQJVXUYH\IRUPVZKLFK)HVWLYDO OHDGHUVKLSZLOODVNWKHDXGLHQFHWRFRPSOHWHDW HDFKFRQFHUW,QDGGLWLRQWRHYDOXDWLQJJXHVWVಬ VDWLVIDFWLRQWKHVXUYH\VKHOSXVGHWHUPLQHZD\V WRLPSURYHWKHRYHUDOO)HVWLYDOH[SHULHQFHLQ IXWXUH //LVWRI%RDUG0HPEHUVDQGWKHLUDIILOLDWLRQV 5HFHQWOLVWRILQGLYLGXDOVFRUSRUDWLRQVDQG IRXQGDWLRQVWKDWSURYLGHRUJDQL]DWLRQDOVXSSRUW ,56'HWHUPLQDWLRQ/HWWHULI\RXDUHD FbLQGLFDWLQJWD[H[HPSWVWDWXV 2QHEURFKXUHDQGRURQHSUHVVFOLSSLQJ ,,QFRPHFDVKRQO\ &RQWULEXWHG )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG (DUQHG Document found on page 12. Document found on page 13. Document found on pages 14-15. Document found on pages 16-17. 9 of 17 63 ))<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 7RWDO,QFRPH )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG ,,([SHQVHV 3URJUDP )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG *HQHUDODQG$GPLQLVWUDWLYH )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 0DUNHWLQJDQG'HYHORSPHQW )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 7RWDO([SHQVHV )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG ,WHP ,,,2SHUDWLQJ6XUSOXV'HILFLW,QFRPHPLQXV([SHQVHV )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG ,9)XQG%DODQFHDW%HJLQQLQJRI<HDU )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 9$FFXPXODWHG6XUSOXV'HILFLW$GGOLQHV,,,DQG,9 )<%XGJHWFXUUHQW 10 of 17 64 ))<<%XGJHWWSURMHFWHG ,WHPP 9,,Q.LQGG&RQWULEXWLRQVVDWWDFKKVFKHGXOHVVLIIJUHDWHUUWKDQQRIIWRWDOOLQFRPH )<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG ,,YHULI\\WKHHNQRZOHGJHHWKDWWWKHHLQIRUPDWLRQQ VXEPLWWHGGLQQWKLVVDSSOLFDWLRQQLVVWUXHHDQGGFRUUHFWWWRR WKHHEHVWWRIIP\\NQRZOHGJH 1DPH =HQ(GZDUGV 7LWOH ([HFXWLYH'LUHFWRU /DVWW8SGDWH 6WDUWW7LPH )LQLVKK7LPH 3RZHUHGE\)RUPVLWH11 of 17 65 Baroque Music Festival, Corona del Mar P.O. Box 838 Corona del Mar, CA 92625-0838 (949) 760-7887 Executive Committee Wayne Norman, President · Steven Dember, Treasurer · Vina Spiehler, Secretary 2025-2026 Board of Directors Philip Benguhe Project Manager, Sunworks USA-retired Dorothy Boesch, RN Head Nurse, Long Beach Community Hospital - retired Past President, Friends of the Huntington Beach Library Patricia Bril, Immediate Past President Librarian Emerita, California State University, Fullerton - retired Virginia Cassara Realtor, Coldwell Banker – retired Steven Dember, Treasurer Senior Member, Technical Staff, The Boeing Company - retired Carol Moss Kirkwood County Librarian, Los Angeles County - retired Wayne Norman, President Principal Engineer, The Boeing Company - retired Janet Rappaport, Esq. Attorney, International Business, Tax; Adjunct Professor, Chapman University, Fowler School of Law Dr. Vina Spiehler, Secretary Forensic Toxicologist, Spiehler & Associates Lynne Hayward Worley Caribbean/Trans-Atlantic Flight Attendant, Delta Airlines - retired UpdatedJanuary 6, 2026, by Zen Edwards 12 of 17 66 "$ "#"!# %!" "#% "# 2025 Festival Donors, Grants, and Business Contributors 2024-2025 Major Individual Contributors $10,000 or more: Dr. Vina R. Spiehler $5,000 to $9,999: Margaret M. Gates · Thomas A. & Bonnie J. Pridonoff · Steve & Paula Mae Schwartz $3,000 to $4,999: Rochelle Bowe & Michael Ishikawa · Steven & Cynthia Dember $1,000 to $2,999: fifteen donors in this category Up to $999: seventy-six donors in this category Foundation and Government Grants The Colburn Foundation $12,500 (operating grant) Newport Beach Arts Commission Cultural Arts Grant $4,000 Business Contributions - Employee Matching Programs Boeing $5,340 Pimco $243 13 of 17 67 14 of 17 68 15 of 17 69 Ho w t o P u r c h a s e T i c k e t s • Sc a n t h e Q R c o d e to t h e r i g h t or v i s i t bm f - c d m . o r g / t i c k e t s • O r r e t u r n t h e or d e r f o r m e n c l o s e d • O r e m a i l ti c k e t s @ b m f - c d m . o r g • O r p h o n e (9 4 9 ) 7 6 0 - 7 8 8 7 Th e f i v e - c o n c e r t Fe s t i v a l S u b s c r i p t i o n p r i c e o f $ 3 2 5 as s u r e s p r e m i u m p r i o r i t y - a r e a s e a t i n g a t a l l e v e n t s a n d in c l u d e s a p r i v a t e p o s t - c o n c e r t d i n n e r f o l l o w i n g t h e Fe s t i v a l F i n a l e o n S u n d a y , J u n e 2 9 , i n t h e F e l l o w s h i p H a l l , St . M a r k P r e s b y t e r i a n C h u r c h . In d i v i d u a l t i c k e t s a r e s o l d on a c o n c e r t - b y - c o n c e r t b a s i s f o r o p e n s e a t i n g . To g a i n t h e f u l l F e s t i v a l e x p e r i e n c e , p l e a s e n o t e : • S u b s c r i b e r s a r e m a i l e d a s e a t i n g c a r d w i t h t h e i r t i c k e t s t o re s e r v e a s e a t o n a r r i v a l i n t h e p r e m i u m s e a t i n g s e c t i o n a t ea c h v e n u e . O u t s i d e t h i s s e c t i o n , o p e n s e a t i n g i s a v a i l a b l e fo r i n d i v i d u a l t i c k e t - h o l d e r s . • D o o r s o p e n 3 0 m i n u t e s b e f o r e c o n c e r t s t a r t t i m e a t t h e ch u r c h e s ( J u n e 2 2 , 2 3 , 2 9 ) a n d 4 5 m i n u t e s b e f o r e a t Sh e r m a n L i b r a r y & G a r d e n s ( J u n e 2 5 , 2 7 ) , w i t h a c c e s s t o th e G a r d e n s i n c l u d e d i n t h e t i c k e t p r i c e . • $ 1 0 s t u d e n t r u s h t i c k e t s f o r s t u d e n t s a g e d 1 2 – 2 9 a r e av a i l a b l e a t t h e d o o r s u b j e c t t o s p a c e a v a i l a b i l i t y . A v a l i d stu d e n t c a r d a n d p h o t o I D a r e r e q u i r e d . • C o m e e a r l y t o o u r c o n c e r t v e n u e s t o m i n g l e w i t h o t h e r gu e s t s a n d h e a r o u r F e s t i v a l r e g u l a r s , t h e S o u t h C o a s t Br a s s q u i n t e t , p l a y al f r e s c o . • C o m p l i m e n t a r y w i n e & w a t e r s r e c e p t i o n s a r e i n c l u d e d fo r a l l t i c k e t - h o l d e r s . • F r e e p a r k i n g i s a v a i l a b l e a t a l l v e n u e s . A t S h e r m a n L i b r a r y & G a r d e n s t h e r e i s s t e p - f r e e a c c e s s f r o m t h e l o w e r s i d e ga t e o n D a h l i a A v e n u e . • W h a t s h o u l d I w e a r ? G u e s t s t y p i c a l l y w e a r s m a r t c a s u a l or b u s i n e s s a t t i r e . L a y e r s a r e r e c o m m e n d e d . Y o u m a y al s o w i s h t o b r i n g a s e a t c u s h i o n t o a l l v e n u e s . La S e r e n i s s i m a : V i v a l d i f o r A l l S e a s o n s Exp e r i e n c e a m e m o r a b l e m u s i c a l j o u r n e y t h i s s u m m e r to La S e r e n i s s i m a — t h e B a r o q u e V e n i c e o f A n t o n i o Viv a l d i ! I n i m i t a b l e a r t i s t i c d i r e c t o r a n d vi o l i n i s t Eli z a b e t h B l u m e n s t o c k , to g e t h e r wi t h t h e F e st i v a l ’ s o r c h e s t r a , c h o r u s a n d so l o i s t s , b r i n g y o u v i b r a n t i n t e r p r e t a t i o n s of Th e F o u r S e a s o n s ; V i v a l d i ’ s c h o r a l de l i g h t , Glo r i a ; h i s o n l y l u t e c o n c e r t o ; an d f a s c i n a t i n g a n d e n j o y a b l e w o r k s b y mo r e 1 8 t h - c e n t u r y m a s t e r s . As w e c o m e t o g e t h e r f o r t h e a n n u a l J u n e s e a s o n t h a t be g a n i n 1 9 8 1 u n d e r F e s t i v a l f o u n d e r B u r t o n K a r s o n , w e we l c o m e y o u , o r w e l c o m e y o u b a c k , f o r fi v e c o n c e r t s o f ric h l y v a r i e d B a r o q u e m u s i c o v e r e i g h t d a y s p e r f o r m e d in i n t i m a t e v e n u e s i n Co r o n a d e l M a r a n d Ne w p o r t B e a c h . Co n c e r t V e n u e s • S t . M a r k P r e s b y t e r i a n C h u r c h 22 0 0 S a n J o a q u i n H i l l s R o a d , N ew p o r t B e a c h • S h e r m a n L i b r a r y & G a r d e n s 26 4 7 E a s t C o a s t H i g h w a y , C o r o n a d e l M a r • S t . M i c h a e l a n d A l l A n g e l s E p i s c o p a l C h u r c h 32 3 3 P a c i f i c V i e w D r i v e , C o r o n a d e l M a r Fe s t i v a l S u p p o r t Ta x - d e d u c t i b l e d o n a t i o n s a n d c o n c e r t s p ons o r s h i p s ar e w e l c o m e d , a s t i c k e t r e v e n u e c o v e r s o n l y 2 5 % o f Fe s t i v a l e x p e n s e s . W e a p p r e c i a t e g i f t s o f a n y a m o u n t a n d ac k n o w l e d g e d o n a t i o n s o f $ 5 0 o r m o r e i n t h e p r i n t e d Fe s t i v a l p r o g r a m . V i s i t bm f - c d m . o r g / s u p p o r t - u s f o r d e t a i l s . Return Address: Name: Street: City, State & Zip: Is this a new address? Yes No Baroque Music Festival, Corona del Mar Post Office Box 838 Corona del Mar, CA 92625-0838 Please Place Stamp Here Baroque Music Festival, Corona del Mar P.O. Box 838, Corona del Mar, CA 92625-0838 NONPROFIT ORG U. S. POSTAGE PAID SANTA ANA, CA PERMIT NO. 1367 RETURN SERVICE REQUESTED Blu m e n s t o c k 45 t h A n n u a l S e a s o n La S e r e n i s s i m a : Vi v a l d i f o r A l l S e a s o n s Ju n e 2 2 – 2 9 , 2 0 2 5 Eli z a b e t h B l u m e n s t o c k Ar t i s t i c D i r e c t o r Reserve your subscription now and join us June 22–29 for “La Serenissima: Vivaldi for All Seasons” Fe s t i v a l Su b s c r i p t i o n in c l u d e s P r e m i u m Sea t i n g & F i n a l e Din n e r ! 16 of 17 70 Su n d a y , J u n e 2 2 , 2 0 2 5 St . M a r k P r e s b y t e r i a n C h u r c h , 4 p . m . Th e F o u r S e a s o n s A r a r e o p p o r t u n i t y t o h e a r E l i z a b e t h B l u m e n s t o c k in V i v a l d i ’ s s e m i n a l c o n c e r t o s e t , w h i c h c e l e b r a t e s it s 3 0 0 t h a n n i v e r s a r y o f p u b l i c a t i o n i n 2 0 2 5 . Plu s , V i v a l d i ’ s Co n c e r t o f o r L u t e , R V 9 3 ( s o l o i s t St e p h e n S t u b b s ) , a n d o r c h e s t r a l w o r k s . Fo l l o w e d b y a w i n e & w a t e r s r e c e p t i o n o n t h e p a t i o w i t h t h e m u s i c i a n s Mo n d a y , J u n e 2 3 , 2 0 2 5 St. M i c h a e l a n d A l l A n g e l s E p i s c o p a l C h u r c h , 7 : 3 0 p . m . Jo y s C e l e s t i a l Jo h n T h i e s s e n ( t r u m p e t ) a n d S t . M i c h a e l ’ s m u s i c dir e c t o r L u k a s H a s l e r ( o r g a n ) , w i t h g u e s t Je n n i f e r E l l i s K a m p a n i ( s o p r a n o ) , i n f a v o r i t e s b y Ba c h , H a n d e l , S c a r l a t t i , T o r e l l i a n d V i v a l d i . Fo l l o w e d b y a w i n e & w a t e r s r e c e p t i o n o n t h e p a t i o w i t h t h e m u s i c i a n s We d n e s d a y , J u n e 2 5 , 2 0 2 5 Sh e r m a n L i b r a r y & G a r d e n s , 7 : 3 0 p . m . A ‘ W i n d y ’ N i g h t i n t h e G a r d e n s A g r a n d e v e n i n g o f c h a m b e r m u s i c b y B o i s m o r t i e r , Te l e m a n n a n d V i v a l d i p e r f o r m e d b y M i n d y Ro s e n f e l d ( f l u t e ) , L o t D e m e y e r ( o b o e ) , A n n a M a r s h (b a s s o o n ) , E l i z a b e t h B l u m e n s t o c k ( v i o l i n ) , E v a Ly m e n s t u l l ( c e l l o ) a n d I a n P r i t c h a r d ( h a r p s i c h o r d ) . Ga t e s o p e n a t 6 : 4 5 p . m . f o r c o m p l i m e n t a r y w i n e i n t h e G a r d e n s · In t e r m i s s i o n c o f f e e & c o o k i e s · M e e t t h e m u s i c i a n s a f t e r t h e c o n c e r t Fr i d a y , J u n e 2 7 , 2 0 2 5 Sh e r m a n L i b r a r y & G a r d e n s , 7 : 3 0 p . m . Cl a s s i c a l Q u a r t e t s & t h e C e l l i s t ’ s V o i c e Ma s t e r f u l s t r i n g q u a r t e t s b y B o c c h e r i n i , H a y d n an d M o z a r t i n t h e i r s o c i o - h i s t o r i c a l c o n t e x t , fe a t u r i n g E l i z a b e t h B l u m e n s t o c k a n d A n d r e w Mc I n t o s h ( v i o l i n ) , L i n d s e y S t r a n d - P o l y a k ( v i o l a ) an d M i c h a e l K a u f m a n ( c e l l o ) . Ga t e s o p e n a t 6 : 4 5 p . m . f o r c o m p l i m e n t a r y w i n e i n t h e G a r d e n s · In t e r m i s s i o n c o f f e e & c o o k i e s · M e e t t h e m u s i c i a n s a f t e r t h e c o n c e r t Su n d a y , J u n e 2 9 , 2 0 2 5 St . M a r k P r e s b y t e r i a n C h u r c h , 4 p . m . Fe s t i v a l F i n a l e : V i v a l d i ’ s Glo r i a Es t e l í G o m e z ( s o p r a n o ) a n d C e c i l i a D u a r t e ( m e z z o - so p r a n o ) j o i n t h e F e s t i v a l C h o r u s a n d O r c h e s t r a (K a t h r y n A d d u c i , t r u m p e t ) l e d b y B l u m e n s t o c k i n Viv a l d i ’ s u p l i f t i n g Glo r i a . P l u s , V e n e t i a n c o m p o s e r Lo t t i ’ s l a t e - B a r o q u e m a s t e r p i e c e Cr u c i f i x u s f o r e i g h t vo i c e s ; t w o o f V i v a l d i ’ s p r o v o c a t i v e s e c u l a r c a n t a t a s ; an d o r c h e s t r a l w o r k s b y V i v a l d i a n d L o c a t e l l i . Fo l l o w e d b y a w i n e & w a t e r s r e c e p t i o n o n t h e p a t i o w i t h t h e m u s i c i a n s FU L L P R O G R A M I N F O R M A T I O N A N D P E R F O R M E R L I S T S A T BM F - C D M . O R G · P R O G R A M A N D A R T I S T S S U B J E C T T O C H A N G E Th e F e s t i v a l t h a n k s t h e f o l l o w i n g f o r t h e i r s u p p o r t : 20 2 5 S u b s c r i p t i o n a n d S i n g l e - T i c k e t O r d e r F o r m Ple a s e d e t a c h a n d m a i l t o : Bar o q u e M u s i c F e s t i v a l C d M , P . O . B o x 8 3 8 , C o r o n a d e l M a r , C A 9 2 6 2 5 - 0 8 3 8 Ple a s e p r i n t . F e s t i v a l S u b s c r i b e r s a n d s u p p o r t e r s : t h i s i s h o w y o u r n a m e ( s ) wil l a p p e a r i n t h e F e s t i v a l p r o g r a m , i f o r d e r i s r e c e i v e d b y M a y 3 1 . Cit y , S t a t e & Z i p Nu m b e r & S t r e e t Nam e ( s ) Ad d r e s s Ph o n e Em a i l P r i c e Q u a n t i t y T o t a l Fe s t i v a l S u b s c r i p t i o n $3 2 5 (a l l 5 c o n c e r t s / p r e m i u m s e a t i n g & Ju n e 2 9 p o s t - c o n c e r t d i n n e r ) Sin g l e t i c k e t s : Th e F o u r S e a s o n s $ 5 0 Su n d a y , J u n e 2 2 — 4 : 0 0 p . m . Jo y s C e l e s t i a l $ 4 5 Mo n d a y , J u n e 2 3 — 7 : 3 0 p . m . A ‘ W i n d y ’ N i g h t i n t h e G a r d e n s $ 5 5 We d n e s d a y , J u n e 2 5 — 7 : 3 0 p . m . Cla s s i c a l Q u a r t e t s & t h e C e l l i s t ’ s V o i c e $ 5 5 Fri d a y , J u n e 2 7 — 7 : 3 0 p . m . Fes t i v a l F i n a l e : V i v a l d i ’ s Glo r i a $5 0 Su n d a y , J u n e 2 9 — 4 : 0 0 p . m . Se r v i c e c h a r g e $ 5 . 0 0 Ad d i t i o n a l t a x - d e d u c t i b l e c o n t r i b u t i o n * To t a l A m o u n t $ My c h e c k p a y a b l e t o “ B a r o q u e M u s i c F e s t i v a l , C d M ” i s e n c l o s e d . Ch a r g e m y c r e d i t c a r d i n f u l l : Ma s t e r c a r d V i s a A m E x D i s c o v e r Cr e d i t c a r d n u m b e r : * * Ca r d E x p i r a t i o n D a t e Se c u r i t y c o d e Mo n t h Y e a r Re q u i r e d Si g n a t u r e : Da t e : Cov e r : Art i s t u n k n o w n ( 1 7 2 3 ) , Viv a l d i , M u s e o I n t e r n a z i o n a l e e B i b l i o t e c a d e l l a M u s i c a d i B o l o g n a ; Can a l e t t o ( 1 7 3 0 ) , Buc e n t a u r ’ s R e t u r n t o t h e P i e r b y t h e P a l a z z o D u c a l e , Uff i z i G a l l e r y . Ph o t o c r e d i t s a b o v e ( l e f t t o r i g h t ) : Big S h o t / C h r i s t i a n J u n g w i r t h , A m e r i c a n B a c h S o l o i s t s , She l b y L e w i s , H a l e y F r e e d l u n d , A s h k a n I m a g e , P h i l h a r m o n i a B a r o q u e , M i r a n d a L o u d . *D o n o r tie r s : Ph i l a n t h r o p i s t ..$1 0 , 0 0 0 + Par t n e r .... . . . . . . . . . . . . $5 , 0 0 0 + Ben e f a c t o r ... . . . . . . . $3 , 0 0 0 + Pat r o n ... . . . . . . . . . . . . . . $1 , 0 0 0 + Do n o r ... . . . . . . . . $5 0 0 + Con t r i b u t o r ..$3 0 0 + Fri e n d ... . . . . . . . . $1 2 5 + Su p p o r t e r . . . . . . . . $ 5 0 + Vis i t bm f - c d m . o r g fo r s p o n s o r s h i p in f o & d o n o r ben e f i t s La S e r e n i s s i m a : V i v a l d i f o r A l l S e a s o n s Eli z a b e t h B l u m e n s t o c k , A r t i s t i c D i r e c t o r ** W e u s e P a y P a l ’ s c r e d i t c a r d p r o c e s s i n g s e r v i c e f o r n o n p r o f i t s t o k e e p o u r t i c k e t - o r d e r s e r v i c e ch a r g e l o w . A P a y P a l a c c o u n t i s not re q u i r e d t o u s e c r e d i t c a r d s f o r F e s t i v a l t i c k e t s . 17 of 17 71 &&XOWXUDO$UWV*UDQWV$SSOLFDWLRQ)RUP 5HIHUHQFH 6WDWXV &RPSOHWH /RJLQ8VHUQDPH EHOOLRWW#FKRUDODUWVLQLWLDWLYHRUJ /RJLQ(PDLO EHOOLRWW#FKRUDODUWVLQLWLDWLYHRUJ 3RSXODU1DPHRI2UJDQL]DWLRQ &KRUDO$UWV,QLWLDWLYH /HJDO1DPHLIGLIIHUHQW&KRUDO$UWV,QLWLDWLYH )HGHUDO7D[,'1R 0DLOLQJ$GGUHVV %DUUDQFD3DUNZD\ &LW\=LSFRGH &RQWDFW1DPH %UDQGRQ(OOLRWW 3KRQHQXPEHU (PDLODGGUHVV EHOOLRWW#FKRUDODUWVLQLWLDWLYHRUJ :HEVLWH KWWSVZZZFKRUDODUWVLQLWLDWLYHRUJ *HRJUDSKLFDO$UHD6HUYHG 2UDQJH&RXQW\,UYLQH1HZSRUW%HDFKIRFXV +DYH\RXUHFHLYHGD&LW\RI1HZSRUW%HDFK &XOWXUDO$UWV*UDQWEHIRUH" 1R ,IVRZKDW\HDUGLG\RXUHFHLYHDJUDQW"1$ <HDURUJDQL]DWLRQZDVIRXQGHG 1XPEHURISDLGVWDII 1XPEHURIDFWLYHYROXQWHHUV 7RWDODPRXQWUHTXHVWHGIURPUHTXHVWOLQHRI SURMHFWEXGJHW (VWLPDWHGQXPEHURISHRSOHLQ1HZSRUW%HDFK WKDWWKHSURSRVHGSURMHFWVZLOOVHUYH &KRUDO$UWV,QLWLDWLYH&$,LVDSURIHVVLRQDO FKRUDORUJDQL]DWLRQGHGLFDWHGWRDGYDQFLQJDQG %ULHIO\GHVFULEHEHORZ\RXURUJDQL]DWLRQ V SXUSRVHPLVVLRQDQGJRDOV ATTACHMENT C 72 FHOHEUDWLQJWKHZRUNRIOLYLQJFRPSRVHUV2XU PLVVLRQLVಯ,QVSLUHGE\WKHFDOOWRFKDPSLRQQHZ FKRUDOPXVLF&KRUDO$UWV,QLWLDWLYHZRUNVLQ SDUWQHUVKLSZLWKFRPSRVHUVDQGWKHFRPPXQLW\ WRLOOXPLQDWHHPHUJLQJFKRUDOPXVLFDQGWR LQVSLUHPXVLFDOFUHDWLYLW\ರ2XUYLVLRQLVWREHWKH ZRUOGFODVVGHVWLQDWLRQIRUQHZFKRUDOPXVLF ZKHUHFRPSRVHUVVLQJHUVDQGDXGLHQFHVFRPH WRJHWKHUWRFUHDWHH[SHULHQFHDQGFXOWLYDWHWKH IXWXUHRIWKHDUWIRUP&$,FRPPLVVLRQVPHQWRUV DQGSUHVHQWVLQQRYDWLYHFKRUDOZRUNVHQULFKHV WKHFXOWXUDOODQGVFDSHDQGRIIHUVWUDQVIRUPDWLYH DUWLVWLFH[SHULHQFHVIRUWKH1HZSRUW%HDFK FRPPXQLW\ &KRUDO$UWV,QLWLDWLYHKDVSHUIRUPHGDOPRVW H[FOXVLYHO\LQ1HZSRUW%HDFKIRU\HDUV HVWDEOLVKLQJGHHSURRWVLQWKHFRPPXQLW\DQG FRQVLVWHQWO\VHUYLQJORFDODXGLHQFHV,QIDFWWKHLU LQDXJXUDOSHUIRUPDQFHZKHQWKH\ZHUHIRXQGHG ZDVLQ1HZSRUW%HDFK7KH1HZSRUW%HDFK 0DVWHU$UWV &XOWXUH3ODQLGHQWLILHVDFLW\ZLGH JRDOWRಯSURYLGHLPSURYHGDQGH[SDQGHGDUWVDQG FXOWXUDOIDFLOLWLHVDQGSURJUDPVWRWKH FRPPXQLW\ರ7KHSODQಬVLQYHQWRU\RIH[LVWLQJ RIIHULQJVLQFOXGHVYLVXDODUWVEDOOHWILOP OHFWXUHVDQGWUDGLWLRQDOFODVVLFDOSURJUDPPLQJ EXWGRHVQRWOLVWDQ\FRQWHPSRUDU\FKRUDO RUJDQL]DWLRQVRUSURJUDPV7KLVDEVHQFH LQGLFDWHVDFOHDUJDSLQDFFHVVWRLQQRYDWLYH YRFDODUWVH[SHULHQFHVZLWKLQ1HZSRUW%HDFK &$,ಬVSHUIRUPDQFHKLVWRU\GHPRQVWUDWHVORFDO GHPDQGIRUWKLVJHQUH2YHUWKHSDVWILYH\HDUV &$,SHUIRUPDQFHVLQ1HZSRUW%HDFKKDYH DWWUDFWHGದDWWHQGHHVZLWKದRI DXGLHQFHPHPEHUVUHVLGLQJLQ1HZSRUW%HDFK =,3FRGHV3RVWFRQFHUWVXUYH\VIURP ದVKRZHGWKDWRIUHVSRQGHQWV ,GHQWLI\DQGGHVFULEHZK\WKHUHLVDQHHGLQ WKH1HZSRUW%HDFK&RPPXQLW\IRU\RXU SURSRVHGSURMHFWSURJUDP,QFOXGHDTXDQWLWDWLYH GHVFULSWLRQRIWKHQHHGDQGRQZKDW\RXEDVHG \RXUILQGLQJVLHಯ%DVHGRQDVWXG\GRQHE\WKH 37$WKHUHDUHRQHKXQGUHGFKLOGUHQLQWKHWK WKJUDGHVDW1HZSRUW(OHPHQWDU\ZKRKDYHKDG QRWUDLQLQJZLWKPXVLFDOLQVWUXPHQWVರ'HVFULEH KRZ\RXKDYHGHWHUPLQHGWKDW\RXURUJDQL]DWLRQ LVWKHEHVWRUJDQL]DWLRQIRUWKHSURSRVHGSURMHFW SURJUDP 73 ZLVKHGIRUPRUHFRQWHPSRUDU\RUQHZPXVLF SURJUDPPLQJLQWKHFLW\7KLVLQGLFDWHVVWURQJ FRPPXQLW\LQWHUHVWLQWKHW\SHRIDUWLVWLF H[SHULHQFH&$,SURYLGHV &$,LVXQLTXHO\SRVLWLRQHGWRPHHWWKLVQHHG)RU FRQVHFXWLYH\HDUV&$,KDVSHUIRUPHGDOPRVW H[FOXVLYHO\LQ1HZSRUW%HDFKDQGKDVSUHPLHUHG RYHUQHZZRUNVE\OLYLQJFRPSRVHUV1RRWKHU DUWVRUJDQL]DWLRQLQWKHUHJLRQRIIHUV FRQWHPSRUDU\FKRUDOSURJUDPPLQJDWWKLVDUWLVWLF OHYHORUFRQVLVWHQF\&$,ಬVGHHSORFDOSUHVHQFH QDWLRQDOUHSXWDWLRQDQGSURYHQWUDFNUHFRUG PDNHLWWKHPRVWTXDOLILHGRUJDQL]DWLRQWRGHOLYHU WKLVSURMHFW &KRUDO$UWV,QLWLDWLYHSURSRVHVಯ0HPRU\ 5HQHZDOರDSXEOLFFRQWHPSRUDU\FKRUDO SHUIRUPDQFHRQ6XQGD\0D\DW 30DW6W0DUN3UHVE\WHULDQ&KXUFK6DQ -RDTXLQ+LOOV5G1HZSRUW%HDFK&$ 7KLVSHUIRUPDQFHFRQWLQXHV&$,ಬV\HDU WUDGLWLRQRIEULQJLQJKLJKTXDOLW\FRQWHPSRUDU\ FKRUDOPXVLFGLUHFWO\WR1HZSRUW%HDFK UHVLGHQWV7KHSURJUDPIHDWXUHVZRUNV H[FOXVLYHO\E\OLYLQJFRPSRVHUVLQFOXGLQJ'DOH 7UXPERUH7UDF\:RQJ$\DQQD:RRGV0LFKDHO *LOEHUWVRQ6DUDK4XDUWHO-RUGDQ6PLWK 5H\QROGVDQG$QGUHZ%RQDFFL7KHSURMHFW RIIHUV1HZSRUW%HDFKUHVLGHQWVDQHQJDJLQJ DUWLVWLFH[SHULHQFHFHQWHUHGRQWKHPHVRI PHPRU\FRPPXQLW\DQGUHQHZDO 352-(&7,03/(0(17$7,21$1'7,0(/,1( -DQXDU\ದ0DUFK6FRUHSUHSDUDWLRQDUWLVWLF SODQQLQJFRPSRVHUHQJDJHPHQWPDUNHWLQJ RXWUHDFKWR1HZSRUW%HDFKUHVLGHQWVDQG VFKRROV $SULOದ0D\:HHNO\UHKHDUVDOVYHQXH 'HVFULEHWKHVSHFLILFSURMHFWSURJUDPWKDWZLOO EHIXQGHGE\DFXOWXUDOJUDQW,QFOXGHKRZWKH SURSRVHGSURMHFWSURJUDPZLOOEHLPSOHPHQWHG DQGRXWOLQHDVFKHGXOHRUSURMHFWWLPHOLQHZLWK SODQQHGGDWHVDQGORFDWLRQV,GHQWLI\LQGLYLGXDOV DQGJURXSVLQYROYHGSDUWLFXODUO\DUWLVWVDQG SHUIRUPHUVDQGGHVFULEHWKHLUUROHVDQG UHVSRQVLELOLWLHV'HVFULEHWKHEDFNJURXQGDQG TXDOLILFDWLRQVRI\RXURUJDQL]DWLRQDQGNH\ SHUVRQQHOWREHLQYROYHGLQWKHSURJUDP 5HPHPEHUWKH&LW\IXQGVRQO\SURMHFWVDQG SURJUDPVQRWRSHUDWLQJH[SHQVHV7KHVH SURMHFWVDQGSURJUDPVPXVWSURPRWHFRPPXQLW\ LQYROYHPHQWDQGDZDUHQHVVRIWKHDUWVLQ 1HZSRUW%HDFK 74 FRRUGLQDWLRQVWDJLQJDQGSURGXFWLRQSODQQLQJ 0D\30ORDGLQDQGVRXQGFKHFN 30SUHFRQFHUWDXGLHQFHHQJDJHPHQW 30SXEOLFSHUIRUPDQFHFRPPXQLW\LQWHUDFWLRQ DQGORDGRXWIROORZLQJWKHFRQFHUW ,1',9,'8$/6$1'*52836,192/9(' 3HUIRUPHUVSURIHVVLRQDOVLQJHUVIURP&KRUDO $UWV,QLWLDWLYH $UWLVWLF'LUHFWRU'U%UDQGRQ(OOLRWWOHDGVDOO DUWLVWLFDQGSURGXFWLRQHOHPHQWV &RPSRVHUV3URYLGHSURJUDPQRWHVDQG SDUWLFLSDWHLQHQJDJHPHQWDFWLYLWLHVOLYHRUYLD UHFRUGHGFRQWHQW 6XSSRUW7HDP6HFWLRQOHDGHUVDGPLQLVWUDWLYH VWDIIYROXQWHHUVDQGYHQXHSDUWQHUV 25*$1,=$7,21$/48$/,),&$7,216 &$,LVDQDWLRQDOO\UHFRJQL]HGQRQSURILWWKDWKDV SUHPLHUHGRYHU ZRUNVUHOHDVHGPXOWLSOH%LOOERDUGFKDUWLQJ DOEXPVDQGUHFHLYHGUHFRJQLWLRQIURP&KRUXV $PHULFD$&'$DQGRWKHUDUWVRUJDQL]DWLRQV'U %UDQGRQ(OOLRWWEULQJVRYHU\HDUVRI H[SHULHQFHLQFRQWHPSRUDU\FKRUDOSURJUDPPLQJ DQGKROGVDGYDQFHGGHJUHHVLQFKRUDO FRQGXFWLQJDQGRUJDQL]DWLRQDOOHDGHUVKLS&$,ಬV SURIHVVLRQDOVLQJHUVDQG$UWLVWLF/HDGHUVKLS 7HDPEULQJVSHFLDOL]HGH[SHUWLVHLQQHZPXVLF SHUIRUPDQFHDQGFRPPXQLW\HQJDJHPHQW ,,VWKLVDQHZRUH[LVWLQJSURMHFWSURJUDP"1HZSURJUDP 7KHSURMHFWZLOOVHUYHUHVLGHQWVRI1HZSRUW %HDFKDQGVXUURXQGLQJFRPPXQLWLHVZLWK H[SHFWHGDWWHQGDQFHEHWZHHQDQG LQGLYLGXDOV%HFDXVH&$,KDVSHUIRUPHGLQ 1HZSRUW%HDFKIRU\HDUVWKHPDMRULW\RIRXU OR\DODXGLHQFHEDVHFRPHVIURPWKHVXUURXQGLQJ 'HILQHRUGHVFULEHWKHVHJPHQWRIWKH SRSXODWLRQLQ1HZSRUW%HDFKWKDW\RXLQWHQGWR VHUYHE\\RXUSURMHFWSURJUDP,QFOXGHVXFK WKLQJVDVDJHORFDWLRQQXPEHUVVHUYHGHWF 75 QHLJKERUKRRGV+LVWRULFDOWLFNHWLQJGDWDVKRZV WKDWದRIDWWHQGHHVUHVLGHLQ1HZSRUW %HDFK=,3FRGHV $XGLHQFHGHPRJUDSKLFVW\SLFDOO\UDQJHIURP \RXQJDGXOWVWRVHQLRUVZLWKPRVWDWWHQGHHV EHWZHHQDJHVDQG2XWUHDFKZLOOWDUJHW 1HZSRUW%HDFKKRXVHKROGVORFDOVFKRROVVHQLRU FRPPXQLWLHVDQGWKH6DQ-RDTXLQ+LOOV QHLJKERUKRRG$FFHVVLEOHWLFNHWLQJHQVXUHV SDUWLFLSDWLRQIURPDZLGHUDQJHRIUHVLGHQWV 3352-(&7%8'*(7([SHQVHV3HUVRQQHO $UWLVWLF )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV $GPLQLVWUDWLYH )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 7HFKQLFDO3URGXFWLRQ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 352-(&7%8'*(7([SHQVHV2SHUDWLQJ )DFLOLW\([SHQVH6SDFH5HQWDO )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 0DUNHWLQJ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 3URGXFWLRQ([KLELWLRQ([SHQVH )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK 76 ))XQGLQJIURP2WKHU6RXUFHV 7RXULQJ3UHVHQWDWLRQ([SHQVH )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV (GXFDWLRQ0DWHULDOV )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 7UDQVSRUWDWLRQ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV (TXLSPHQW )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 2WKHULIJUHDWHUWKDQDQQRWDWHEHORZ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV *5$1'727$/ ([SHFWHGRXWFRPHVLQFOXGHVHUYLQJದ DWWHQGHHVZLWKDWOHDVWUHVLGLQJLQ1HZSRUW %HDFK2XUORQJVWDQGLQJ\HDU1HZSRUW SUHVHQFHHQVXUHVUHOLDEOHWXUQRXWDQGSURYLGHVD FOHDUEDVHOLQHIRUPHDVXULQJFRPPXQLW\GHPDQG DQGVDWLVIDFWLRQ2QHIXOOOHQJWKFKRUDOFRQFHUW IHDWXULQJVHYHQOLYLQJFRPSRVHUVZLOOEH SUHVHQWHG$WOHDVWPLQXWHVRIDXGLHQFH HQJDJHPHQWDFWLYLWLHVZLOOEHSURYLGHGEHIRUH DQGDIWHUWKHFRQFHUW :HDLPWRUHDFKDWOHDVW1HZSRUW%HDFK UHVLGHQWVWKURXJKPDUNHWLQJDQGRXWUHDFK3RVW FRQFHUWVXUYH\VZLOOPHDVXUHVDWLVIDFWLRQZLWKD 'HVFULEHWKHH[SHFWHGTXDQWLILDEOHRXWFRPHV RI\RXUSURMHFWSURJUDPDQGKRZ\RXZLOO HYDOXDWHWKHUHVXOWV%HYHU\VSHFLILFLQ DGGUHVVLQJWKHZD\VWKDW\RXZLOOGHWHUPLQHWKDW \RXUSURMHFWSURJUDPPHWWKHQHHGVWKDW\RX LGHQWLILHGDQGDFFRPSOLVKHVWKHJRDOV\RXVHWRXW WRDFKLHYHLH\RXSURYLGHKRXUVRIPXVLFDO LQVWUXFWLRQDQGLQVWUXPHQWVWRWKHFKLOGUHQDW 1HZSRUW(OHPHQWDU\VFKRRODVPHDVXUHGE\ PXVLFVWRUHUHQWDOUHFHLSWVDQGORJVRI LQVWUXFWRUV 77 JRDORISRVLWLYHUDWLQJVDQGDWOHDVWRI UHVSRQGHQWVH[SUHVVLQJLQWHUHVWLQPRUH FRQWHPSRUDU\SURJUDPPLQJ(YDOXDWLRQPHWKRGV LQFOXGHWLFNHWLQJDQG=,3FRGHDQDO\VLV DWWHQGDQFHFRXQWVGLJLWDOHQJDJHPHQWPHWULFV VWDIIUHSRUWVDQGVXUYH\GDWDDOORZLQJ&$,WR DVVHVVZKHWKHUWKHSURMHFWPHWWKHLGHQWLILHG QHHGVDQGJRDOV //LVWRI%RDUG0HPEHUVDQGWKHLUDIILOLDWLRQV 5HFHQWOLVWRILQGLYLGXDOVFRUSRUDWLRQVDQG IRXQGDWLRQVWKDWSURYLGHRUJDQL]DWLRQDOVXSSRUW ,56'HWHUPLQDWLRQ/HWWHULI\RXDUHD FbLQGLFDWLQJWD[H[HPSWVWDWXV 2QHEURFKXUHDQGRURQHSUHVVFOLSSLQJ , ,QFRPHFDVKRQO\ &RQWULEXWHG )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG (DUQHG )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 7RWDO,QFRPH )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG ,, ([SHQVHV 3URJUDP )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG *HQHUDODQG$GPLQLVWUDWLYH Document found on page 10. Document found on page 11. Document found on page 12. Document found on pages 13-17. 78 ))<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG 0DUNHWLQJJDQGG'HYHORSPHQW )<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG 7RWDOO([SHQVHV )<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG ,WHPP ,,, 2SHUDWLQJJ6XUSOXV'HILFLWW,QFRPHHPLQXVV([SHQVHV )<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG ,9 )XQGG%DODQFHHDWW%HJLQQLQJJRII<HDU )<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG 9 $FFXPXODWHGG6XUSOXVV'HILFLW$GGGOLQHVV,,,,DQGG,9 )<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG ,WHPP 9, ,Q.LQGG&RQWULEXWLRQVVDWWDFKKVFKHGXOHVVLIIJUHDWHUUWKDQQRIIWRWDOOLQFRPH )<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG ,,YHULI\\WKHHNQRZOHGJHHWKDWWWKHHLQIRUPDWLRQQ VXEPLWWHGGLQQWKLVVDSSOLFDWLRQQLVVWUXHHDQGGFRUUHFWWWRR WKHHEHVWWRIIP\\NQRZOHGJH 1DPH %UDQGRQ(OOLRWW 7LWOH ([HFXWLYH'LUHFWRU 79 //DVW8SGDWH 6WDUW7LPH )LQLVK7LPH 3RZHUHGE\)RUPVLWH 80 Brandon Elliott, Artistic & Executive Director | 2160 Barranca Pkwy #1262, Irvine, CA 92606 | choralartsinitiative.org Board Directory As of December 1, 2025 Hannah McMeans, JD, Chairperson of the Board Meyers Nave Lorraine Joy Welling, Vice Chairperson of the Board Anaheim Union High School District Chihiro Ando, Treasurer Independent Tech Consultant Bonnie Pridonoff, Secretary Long Beach Camerata Singers; Paciﬁc Chorale Beth Eslick, Member at Large (Exiting) Conejo Players Theatre Brandon Elliott, Ed.D., Member at Large Saddleback College & Disney Live Entertainment 81 Brandon Elliott, Artistic & Executive Director | 2160 Barranca Pkwy #1262, Irvine, CA 92606 | choralartsinitiative.org Recent Contributors (Last Two Fiscal Years) FOUNDATIONS Samueli Foundation Amphion Foundation New Music USA – Organization Fund Ronald L. Katz Foundation Christian Life Foundation GOVERNMENTAL AGENCIES California Arts Council California Office of the Small Business Advocate California Governor’s Office of Business and Economic Development CORPORATE SUPPORT Santiago Financial, Inc. CCB Financial Services, Inc. Wells Fargo Foundation INDIVIDUAL SUPPORT Choral Arts Initiative is supported by a broad base of individual donors from across Newport Beach and Orange County, including more than 150 households who contributed within the last two ﬁscal years. Donors include members of the CAI audience community, singers and alumni, board members, and long-time arts supporters. Additional donors have chosen to give anonymously. 82 83 Peter Lefevre · Jun 17, 2024 · 5 min read Choral Arts Initiative Premiere | ProjectFestival Supports Innovations inComposition Twelve composers will join the Choral Arts Initiative for a three-day festival to develop new work, culminating in a concert with 12 world premieres. These 12 composers have been chosen to develop a composition in progress or a completed work to be adjusted during their mentoring and workshops during this year's Support for Culture OC comes from Become a Sponsor 12/1/25, 1:45 PM ChoralArts Initiative Premiere | Project Festival Supports Innovations in Composition https://www.cultureoc.org/post/choral-arts-initiative-premiere-project-festival-supports-innovations-in-composition 1/684 Choral Arts Initiative founding artistic and executive director Brandon Elliott. Photo courtesy of Choral Arts Initiative/Vini Kare Premiere | Project Festival. Photos courtesy of Choral Arts Initiative For the past 12 years, Orange County’s Choral Arts Initiative (CAI) has championed the emerging voices of contemporary vocal music, and since 2015 that work has included its annual Premiere/Project Festival. Under the guidance of artistic director Brandon Elliott, the festival brings together composers from throughout the world, matches them with some of the region’s most accomplished vocal artists, and brings these exploratory and innovative choral works to life through workshops and performances. The culminating performance of this year’s festival takes place at Concordia University Irvine’s Zhang Hall on June 28. The festival’s 12 participating composers represent a wide range of backgrounds and experiences and are drawn from throughout the world, from China to Gardena, New Zealand to Utah. “Choral Arts Initiative is Orange County’s only professional chorus solely devoted to new music,” says Elliott. “There’s no other organization in Orange County that has commissioned more or premiered more choral works. If listeners want their nger on pulse of what’s new in the choral world, look no further than us. “In addition, we’re really committed to community engagement programs like this one. Since its rst iteration, it’s been nationally recognized as one of the premier incubators and accelerators for composers, which is great to see internally. We’ve almost dropped our marketing budget because word of mouth brings us way more applications than we can accommodate.” This year’s festival will be the fth since 2015. The festival was canceled in 2020 and 2021 due to the pandemic. Ironically, Elliott grew up wanting to stay far away from the performing arts. As a student at Irvine High School, he was headed in a di|erent direction before his principal and a sage teacher intervened. “I found my way into this career by mistake. As a freshman you have to choose between athletics and the arts. I chose cross country, even though I hate running. I had such a terrible time they kicked me o|the team and the principal put me in beginning choir. That was the beginning of 12/1/25, 1:45 PM ChoralArts Initiative Premiere | Project Festival Supports Innovations in Composition https://www.cultureoc.org/post/choral-arts-initiative-premiere-project-festival-supports-innovations-in-composition 2/685 Brandon Elliott facilitates an in-depth seminar on the business and legal aspects of music composition as part of the Premiere|Project Festival in Irvine. Image courtesy of Choral Arts Initiative my next stage of life. I’m still in touch with my choir teacher, Richard Messenger, who started my love for vocal music.” That detour resulted in Elliott’s commitment to new music and his creation of the festival. More than an opportunity for composers to hear their compositions in performance, the festival is a professional development opportunity, giving them comprehensive support for their careers. The works are developed through a week-long workshop residency, sung by a professional chorus, with mentorship from composition faculty. For those selected, it can be a valuable career boost. “The composers we select can launch successful careers as composers through their work here,” says Elliott. “We’re the only festival I know of where composers realize an immediate economic benet. A publication deal that, within 48 hours of the performance, they can go live with their work that anyone can publish and perform.” The festival, part of CAI’s 12thseason, themed “Threads of Connection,” promises to be adventurous both musically and textually. The art of composition is continually evolving, and the creative artists selected for this iteration of the festival are challenging themselves to reach more personal and heartfelt subjects for vocal treatment. “We’re seeing the text selection leaving the dogma of sacred text,” Elliott says. “There’s not as many Kyries, Glorias and Masses. We’re seeing texts that are not even poetry but prose, texts that are speaking to lived experience, that are social justice- oriented, texts about hunger, about people with no shelter, about the crisis in Ukraine. There’s one about gender transition, one about the climate crisis, one about war. It’s a paradigm shift away from what we would normally hear. It’s much more contemporary to lived experiences. the diversity is more vibrant than ever. “There composers are questioning tuning systems, time and meter itself. We’re seeing extremes. What’s also popular now is more infusion of electronics with voices. It’s been around for a while, but when it rst emerged, it was ahead of its time. Now it’s really taking o|.” One of the challenges Elliott faces is the sheer volume of submissions. In its initial year, the festival saw 1,500 applications and provided feedback to nearly 400 composers. With that much interest, how does the festival make its ultimate selections? “We’re looking at a couple things,” Elliott says. “The application they submit includes a proposal of what they’re going to be writing about, what they would write about if they were accepted. That’s a compelling part of the application to get into the festival. 12/1/25, 1:45 PM Choral Arts Initiative Premiere | Project Festival Supports Innovations in Composition https://www.cultureoc.org/post/choral-arts-initiative-premiere-project-festival-supports-innovations-in-composition 3/686 They’re bringing a brand new work, so we’d like to see something as detailed as possible, what they plan to write, how they plan to execute it, other work they’ve executed, a sense of style, salience, that gives a good indication of whether we’re going to accept them or not. “Also, the fest is informed by diversity, equity, inclusion, and belonging, so there are no formal education requirements,” Elliott continued. “Many festivals require a B.A., M.A., some even a Ph.D. Some of our composers are in high school, or in their 50s or 60s and want to try composing. They’re from all walks of life, and that’s another exciting part. If you look at our 12 composers from this year, they’re from everywhere, all over the world, all di|erent backgrounds. They’re all pretty di|erent, but almost all are selecting texts that really speak to lived experiences today.” WHO ARE THE 2024 COMPOSERS? The composers chosen for this year's festival are: of Los Angeles. She is a Los Angeles-based vocalist, songwriter, multi-instrumentalist and teacher. She teaches students in locations around the world. of Boston, Massachusetts. They are a a composer, singer and educator. A student of music and linguistics, they are completing a master's of education at George Mason University. of Barcelona, Spain. Growing up in a family with no musical tradition, he is a self-taught composer who has gone on to win multiple composing awards. of San Diego. He is a conductor, vocalist, educator and composer with degrees in music and business communication. His music interests include blending modern and traditional techniques. of Los Angeles. He is the director of music at Holy Family Catholic Church in Glendale and has a background steeped in sacred music. of Gardena. A recent Cal State Fullerton graduate, she is studying for her master's degree in composition at UC Riverside. PREMiERE | PROJECT FESTiVAL 2024 CONCLUDiNG PERFORMANCE 7 p.m. June 28 Concordia University Irvine, Borland-Manske Center (Zhang Hall), 1530 Concordia West, Irvine $30 general admission, $15 students choralartsinitiative.org 12/1/25, 1:45 PM Choral Arts Initiative Premiere | Project Festival Supports Innovations in Composition https://www.cultureoc.org/post/choral-arts-initiative-premiere-project-festival-supports-innovations-in-composition 4/687 MUSIC of Syracuse, Utah. He is a software engineer and composer. After a long hiatus from music, he rediscovered his passion for music in 2022 when he starting composing again. of Cheshire, Connecticut. He is a composer, trombonist, pianist/keyboardist, drummer and choral singer. His compositions blend rhythm, drive and vernacular traditions with classical concert techniques. of Los Angeles. As a guitarist growing up primarily inuenced by rock music, which in turn inuences his choral compositions. of North Hollywood. Originally from New Zealand, he is known for composing choral, lm and concert music. His score for "The Reef: Stalked" was nominated for multiple soundtrack awards. of Northampton, Great Britain. A doctor and composer, he has been commissioned by the BBC World Service and Seychelles Broadcasting Corporation. He recently retired early from his medical practice to commit full time to composing. of Beijing, China. Now living in Canada, she worked as an arranger and percussionist for the Vancouver Pops Orchestra and Choir. 12/1/25, 1:45 PM Choral Arts Initiative Premiere | Project Festival Supports Innovations in Composition https://www.cultureoc.org/post/choral-arts-initiative-premiere-project-festival-supports-innovations-in-composition 5/688 &&XOWXUDO$UWV*UDQWV$SSOLFDWLRQ)RUP 5HIHUHQFH 6WDWXV &RPSOHWH /RJLQ8VHUQDPH HPHUDOGPDJLFHYHQWV#JPDLOFRP /RJLQ(PDLO HPHUDOGPDJLFHYHQWV#JPDLOFRP 3RSXODU1DPHRI2UJDQL]DWLRQ (PHUDOG0DJLF(YHQWV /HJDO1DPHLIGLIIHUHQW(PHUDOGPDJLF(YHQWVLQF )HGHUDO7D[,'1R 0DLOLQJ$GGUHVV %D\VLGH'U6WH &LW\=LSFRGH 1(:3257%($&+ &RQWDFW1DPH (OHQD2WWR 3KRQHQXPEHU (PDLODGGUHVV HPHUDOGPDJLFHYHQWV#JPDLOFRP :HEVLWH KWWSVZZZHPHUDOGPDJLFHYHQWVRUJ *HRJUDSKLFDO$UHD6HUYHG 2UDQJH&RXQW\&$ +DYH\RXUHFHLYHGD&LW\RI1HZSRUW%HDFK &XOWXUDO$UWV*UDQWEHIRUH" <HV ,IVRZKDW\HDUGLG\RXUHFHLYHDJUDQW" <HDURUJDQL]DWLRQZDVIRXQGHG 1XPEHURISDLGVWDII 1XPEHURIDFWLYHYROXQWHHUV 7RWDODPRXQWUHTXHVWHGIURPUHTXHVWOLQHRI SURMHFWEXGJHW (VWLPDWHGQXPEHURISHRSOHLQ1HZSRUW%HDFK WKDWWKHSURSRVHGSURMHFWVZLOOVHUYH 2XUPLVVLRQLVWRSUHVHUYHDQGVKDUHWKHULFK FXOWXUDOKHULWDJHRIRXUFLYLOL]DWLRQWKURXJKWKH %ULHIO\GHVFULEHEHORZ\RXURUJDQL]DWLRQ V SXUSRVHPLVVLRQDQGJRDOV 1 of 20 ATTACHMENT D 89 EHDXWLIXODUWRIFODVVLFDOPXVLF2XUPLVVLRQ IRFXVHVRQHQJDJLQJDQGLQVSLULQJWKH\RXQJHU JHQHUDWLRQE\RUJDQL]LQJGLVWLQJXLVKHGFRQFHUWV HYHQWVDQGIHVWLYDOVWKDWKLJKOLJKWWKLVJHQUH 7KH,PSDFWRI(DUO\0XVLF(GXFDWLRQRQ&KLOG 'HYHORSPHQW 5HFHQWUHVHDUFKIURP2[IRUG8QLYHUVLW\ KLJKOLJKWVWKHSURIRXQGLQIOXHQFHRIHDUO\PXVLF HGXFDWLRQRQFKLOGUHQಬVFRJQLWLYHHPRWLRQDODQG DHVWKHWLFJURZWK6WXGLHVVKRZWKDWOHDUQLQJ LQVWUXPHQWVVXFKDVWKHYLROLQDQGSLDQR HQKDQFHVDWWHQWLRQPHPRU\SHUFHSWLRQDQG ODQJXDJHVNLOOV 0XVLFHGXFDWLRQDOVRQXUWXUHVFUHDWLYLW\VRFLDO DGDSWDELOLW\DQGSV\FKRORJLFDOZHOOEHLQJ VXSSRUWLQJRYHUDOOGHYHORSPHQWDQGPHQWDO KHDOWK7KHXVHRIWHFKQRORJ\DQGJDPLILHG OHDUQLQJWRROVIXUWKHUVWUHQJWKHQVFKLOGUHQಬV HPRWLRQDOFRQQHFWLRQWRPXVLFPDNLQJWKH OHDUQLQJSURFHVVPRUHHQJDJLQJDQGLPSDFWIXO &ODVVLFDOLQWKH3DUNದ$VHULHVRIWZR (GXFDWLRQDO(YHQWV ಯ&ODVVLFDOLQWKH3DUNರLVDVHULHVRIWZRRXWGRRU HGXFDWLRQDOHYHQWVFHOHEUDWLQJWKHKLVWRU\DQG KHULWDJHRIFODVVLFDOPXVLF+HOGLQRSHQVSDFHV DFURVV2UDQJH&RXQW\VXFKDVSDUNVDQGVFKRRO SOD\JURXQGVHDFKHYHQWFRPELQHVOLYH SHUIRUPDQFHVVWRU\WHOOLQJDQGPXOWLPHGLD SUHVHQWDWLRQV 8VLQJDOLYHWRKHDGSKRQHVIRUPDWSURIHVVLRQDO PXVLFLDQVDQGWHDFKHUVIURPORFDOPXVLFVFKRROV ZLOOLQWURGXFHFKLOGUHQDQGIDPLOLHVWRWKHJUHDW FRPSRVHUVಧ0R]DUW%DFK%HHWKRYHQ9LYDOGL DQGRWKHUVಧWKURXJKHQJDJLQJVWRULHVDQGOLYH ,GHQWLI\DQGGHVFULEHZK\WKHUHLVDQHHGLQ WKH1HZSRUW%HDFK&RPPXQLW\IRU\RXU SURSRVHGSURMHFWSURJUDP,QFOXGHDTXDQWLWDWLYH GHVFULSWLRQRIWKHQHHGDQGRQZKDW\RXEDVHG \RXUILQGLQJVLHಯ%DVHGRQDVWXG\GRQHE\WKH 37$WKHUHDUHRQHKXQGUHGFKLOGUHQLQWKHWK WKJUDGHVDW1HZSRUW(OHPHQWDU\ZKRKDYHKDG QRWUDLQLQJZLWKPXVLFDOLQVWUXPHQWVರ'HVFULEH KRZ\RXKDYHGHWHUPLQHGWKDW\RXURUJDQL]DWLRQ LVWKHEHVWRUJDQL]DWLRQIRUWKHSURSRVHGSURMHFW SURJUDP 2 of 20 90 UHQGLWLRQVRIWKHLUPDVWHUSLHFHV <RXQJSHUIRUPHUVZLOOKDYHWKHFKDQFHWRMRLQ SURIHVVLRQDOVRQVWDJHZKLOHIDPLOLHVFDQ GLVFRYHURSSRUWXQLWLHVWRHQUROOWKHLUFKLOGUHQLQ ORFDOFODVVLFDOPXVLFSURJUDPV 'HVFULEHWKHVSHFLILFSURMHFWSURJUDPWKDWZLOO EHIXQGHGE\DFXOWXUDOJUDQW,QFOXGHKRZWKH SURSRVHGSURMHFWSURJUDPZLOOEHLPSOHPHQWHG DQGRXWOLQHDVFKHGXOHRUSURMHFWWLPHOLQHZLWK SODQQHGGDWHVDQGORFDWLRQV,GHQWLI\LQGLYLGXDOV DQGJURXSVLQYROYHGSDUWLFXODUO\DUWLVWVDQG SHUIRUPHUVDQGGHVFULEHWKHLUUROHVDQG UHVSRQVLELOLWLHV'HVFULEHWKHEDFNJURXQGDQG TXDOLILFDWLRQVRI\RXURUJDQL]DWLRQDQGNH\ SHUVRQQHOWREHLQYROYHGLQWKHSURJUDP 5HPHPEHUWKH&LW\IXQGVRQO\SURMHFWVDQG SURJUDPVQRWRSHUDWLQJH[SHQVHV7KHVH SURMHFWVDQGSURJUDPVPXVWSURPRWHFRPPXQLW\ LQYROYHPHQWDQGDZDUHQHVVRIWKHDUWVLQ 1HZSRUW%HDFK &ODVVLFDOLQWKH3DUNದ(YHQW'HWDLOV 7KH&ODVVLFDOLQWKH3DUNSURMHFWZLOOWDNHSODFH DWWZRORFDWLRQVLQ1HZSRUW%HDFK&DOLIRUQLD %RQLWD*UHHN&RPPXQLW\&HQWHU /D9LGD1HZSRUW%HDFK&$ 'DWH$XJXVW 1HZSRUW%HDFK-XQLRU/LIHJXDUG%XLOGLQJ (2FHDQIURQW1HZSRUW%HDFK&$ 'DWH6HSWHPEHU 7KHSURMHFWZLOOIHDWXUHKLJKO\SURIHVVLRQDO FODVVLFDOPXVLFWHDFKHUVLQFOXGLQJ/XF\/X 9LROLQಧ)RXQGHURI9LROLQEDE\0XVLF ZZZYLROLQEDE\FRPDQG&RQGXFWRURIWKH 2UDQJH&RXQW\<RXWK6\PSKRQ\6WULQJ (QVHPEOHZZZSKLOKDUPRQLFVRFLHW\RUJRF\V 5RJHU:ULJWKSLDQRWLDFKHUIURP0XVLF6FKRRO DW)RRWKLOOH)RRWKLOO%OYG$UFDGLD&$ &KLOGUHQIURPWKH2UDQJH&RXQW\<RXWK 6\PSKRQ\ZLOODOVRSDUWLFLSDWHDVSHUIRUPHUV VKRZFDVLQJWKHLUWDOHQWDORQJVLGHSURIHVVLRQDO PXVLFLDQV ,VWKLVDQHZRUH[LVWLQJSURMHFWSURJUDP"1HZSURJUDP 7KHSURMHFWLVGHVLJQHGIRUVFKRRODJHGFKLOGUHQ EHWZHHQDQG\HDUVROGDLPLQJWRIRVWHUD ORYHIRUFODVVLFDOPXVLFDQGLQVSLUHWKHPWROHDUQ FODVVLFDOLQVWUXPHQWV3DUHQWVDQGFKLOGUHQIURP 1HZSRUW%HDFKZLOOEHLQYLWHGWRDWWHQG 'HILQHRUGHVFULEHWKHVHJPHQWRIWKH SRSXODWLRQLQ1HZSRUW%HDFKWKDW\RXLQWHQGWR VHUYHE\\RXUSURMHFWSURJUDP,QFOXGHVXFK WKLQJVDVDJHORFDWLRQQXPEHUVVHUYHGHWF 3 of 20 91 7KHWZRHYHQWVDUHH[SHFWHGWRZHOFRPHDURXQG DWWHQGHHVZLWKIUHHWLFNHWVSURYLGHGWRDOO FKLOGUHQWRHQFRXUDJHSDUWLFLSDWLRQDQG FRPPXQLW\HQJDJHPHQW 3352-(&7%8'*(7([SHQVHV3HUVRQQHO $UWLVWLF )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK 1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV $GPLQLVWUDWLYH )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK 1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 7HFKQLFDO3URGXFWLRQ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK 1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 352-(&7%8'*(7([SHQVHV2SHUDWLQJ )DFLOLW\([SHQVH6SDFH5HQWDO )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK 1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 0DUNHWLQJ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK 1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 3URGXFWLRQ([KLELWLRQ([SHQVH )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK 1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 7RXULQJ3UHVHQWDWLRQ([SHQVH )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK 1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 4 of 20 92 ((GXFDWLRQ0DWHULDOV )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK 1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 7UDQVSRUWDWLRQ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK 1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV (TXLSPHQW )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK 1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 2WKHULIJUHDWHUWKDQDQQRWDWHEHORZ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK 1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV *5$1'727$/ 'HVFULEHWKHH[SHFWHGTXDQWLILDEOHRXWFRPHV RI\RXUSURMHFWSURJUDPDQGKRZ\RXZLOO HYDOXDWHWKHUHVXOWV%HYHU\VSHFLILFLQ DGGUHVVLQJWKHZD\VWKDW\RXZLOOGHWHUPLQHWKDW \RXUSURMHFWSURJUDPPHWWKHQHHGVWKDW\RX LGHQWLILHGDQGDFFRPSOLVKHVWKHJRDOV\RXVHWRXW WRDFKLHYHLH\RXSURYLGHKRXUVRIPXVLFDO LQVWUXFWLRQDQGLQVWUXPHQWVWRWKHFKLOGUHQDW 1HZSRUW(OHPHQWDU\VFKRRODVPHDVXUHGE\ PXVLFVWRUHUHQWDOUHFHLSWVDQGORJVRI LQVWUXFWRUV :HPDLQWDLQFRQWDFWZLWKDOOHYHQW DWWHQGHHV$IWHUHDFKHYHQWSDUHQWVZLOOUHFHLYH DTXHVWLRQQDLUHWRSURYLGHIHHGEDFNDQGVKDUH RXWFRPHV7KHVXUYH\ZLOOKHOSDVVHVVWKH SURMHFWಬVLPSDFWE\FROOHFWLQJGHWDLOHGLQIRUPDWLRQ RQKRZPDQ\FKLOGUHQEHJDQWDNLQJPXVLF OHVVRQVIROORZLQJWKHLUSDUWLFLSDWLRQ /LVWRI%RDUG0HPEHUVDQGWKHLUDIILOLDWLRQV 5HFHQWOLVWRILQGLYLGXDOVFRUSRUDWLRQVDQG IRXQGDWLRQVWKDWSURYLGHRUJDQL]DWLRQDOVXSSRUW ,56'HWHUPLQDWLRQ/HWWHULI\RXDUHD FbLQGLFDWLQJWD[H[HPSWVWDWXV 2QHEURFKXUHDQGRURQHSUHVVFOLSSLQJ 5 of 20 Document found on pages 8-10. Document found on page 11. Document found on page 12. Document found on pages 13-20. 93 ,, ,QFRPHFDVKRQO\ &RQWULEXWHG )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG (DUQHG )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 7RWDO,QFRPH )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG ,, ([SHQVHV 3URJUDP )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG *HQHUDODQG$GPLQLVWUDWLYH )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 0DUNHWLQJDQG'HYHORSPHQW )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 7RWDO([SHQVHV )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG ,WHP ,,, 2SHUDWLQJ6XUSOXV'HILFLW,QFRPHPLQXV([SHQVHV )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 6 of 20 94 ,,9 )XQGG%DODQFHHDWW%HJLQQLQJJRII<HDU )<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG 9 $FFXPXODWHGG6XUSOXVV'HILFLW$GGGOLQHVV,,,,DQGG,9 )<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG ,WHPP 9, ,Q.LQGG&RQWULEXWLRQVVDWWDFKKVFKHGXOHVVLIIJUHDWHUUWKDQQRIIWRWDOOLQFRPH )<<%XGJHWWFXUUHQW1$ )<<%XGJHWWSURMHFWHG1$ ,,YHULI\\WKHHNQRZOHGJHHWKDWWWKHHLQIRUPDWLRQQ VXEPLWWHGGLQQWKLVVDSSOLFDWLRQQLVVWUXHHDQGGFRUUHFWWWRR WKHHEHVWWRIIP\\NQRZOHGJH 1DPH (OHQD2WWR 7LWOH *HQHUDO0DQDJHU /DVWW8SGDWH 6WDUWW7LPH )LQLVKK7LPH 3RZHUHGE\)RUPVLWH7 of 20 95 Èº¬½¯°¸°½°±°½½¬·º½¸ Prospective Board Member Information Sheet Name:________________________________________________________________________ Title:_________________________________________________________________________ Organization:__________________________________________________________________ Address:______________________________________________________________________ City, State, Zip:________________________________________________________________ Telephone: Day____________________________ Evening_______________________ Email:________________________________________________________________________ Source of Referral/Information:____________________________________________________ Special Skills ܆Fund-raising ܆Personnel/Human Resources ܆Finances ܆Business ܆Marketing/Public Relations ܆Technology ܆Legal ܆Other:____________________________ Professional Background ܆For-profit business ܆Government ܆Nonprofit organization ܆Other:____________________________ Other affiliations: _______________________________________________________________ Other board service: _____________________________________________________________ Known levels of giving or volunteering: _____________________________________________ Other pertinent information: ______________________________________________________ $&,,' &*$&!* %*$!#.&,+#& /('*,&,** /('*," %*$%!#.&,+!%#$'% %,#&!' ,"'*' #*,'*+ *&,(($#,#'&+*)-+, !&*$%#&#+,*,#. 0(,#'&$ .$#-&,#$ 8 of 20 96 Elena Otto - General manager Emerald Magic Events — Professional Musician & Musical Producer Elena is a professional musician and musical producer known for her creative direction, refined artistry, and dedication to developing musical talent. She plays an active role in the artist and music teacher community of Orange County, where she collaborates with educators, performers, and cultural organizations to promote music education and performance excellence. Her partners and collaborations include a network of local artists, music schools, orchestras, and community arts programs, all united by a shared mission to inspire and nurture the next generation of musicians. Helen’s work bridges performance and mentorship, making her a respected figure in the regional music scene. among them are those such as (partners and collaborations) Lucy Lu Founder at Violinbaby Music www.violinbaby.com Conductor at Orange County Youth Symphony String Ensemble www.philharmonicsociety.org/ocys Vladimir Khomyakov (lead and teacher ) https://www.vladimirkhomyakov.com Glissando 5501(c)3 non-profit education center (art&culture) https://www.glissando.org 01(c)(3) EIN 88-3096113 1(c)(3) EIN 88-3096113 Roger Wrigth -(piano) teacher from Music School at Foothill 323 e.Foothill Blvd ,Arcadia ,CA 91006 THE MUSIC SCHOOL AT FOOTHILL - Updated January 2026 - 323 E Foothill Blvd, Arcadia, California - Musical Instruments & Teachers - Phone Number - Yelp %2$5'0(0%(56$1'$)),/,$7,216 9 of 20 97 Robert Medina Gonzales -CEO Emerald Magic Events — Professional Event Organizer & Sound Engineer Robert is a seasoned event organizer and sound engineer with extensive experience in managing and executing high-profile events. His expertise spans every technical and creative aspect of production, including lighting, audio, video, backline, staging, rigging, booking, power, and special effects. Over the years, Robert has built strong affiliations with leading professional stage equipment companies, maintaining trusted partnerships and collaborations that ensure top-tier quality and reliability for every event he produces. His hands-on approach and technical precision make him a go-to professional for seamless, high-impact productions among them are those such as (partners and collaborations) PCE (Pacific Coast Entertainment) - Live Event Production Rehearsal studio in Santa Ana ,OC ,CA Music Rehearsal and Recording Studio 10 of 20 98 11 of 20 99 12 of 20 100 Emerald Magic Events CLASSICAL MUSIC LIVE CONCERTS & EVENTS MAGAZINE 2026 13 of 20 101 Emerald Magic Events March 2026March2026CLASSICAL MUSICLIVE CONSERTSMAGAZINE Concert -Famous Pieces of Classical Music for Solo Piano Bach, Beethoven, Chopin, Debussy, Mendelssohn, Scarlatti, Schubert, Tchaikovsky and More 5PM -7 PM 2026 Santa Ana College Fine and Performing Arts 1530 West 17th Street Santa Ana, CA 92706 14 of 20 102 Emerald Magic Events May 2026May2026CLASSICAL MUSICLIVE CONSERTSMAGAZINE 11 Musical Event -live to headphones MUSICAL RETREAT . MUSICAL RETREAT violin & piano live to headphone ,meditation ,mental yoga 5PM-7PM William R Mason Regional Park ,IRVINE 2026 15 of 20 103 Emerald Magic Events August 2026August2026CLASSICAL MUSICLIVE CONSERTSMAGAZINE Musical Event -live to headphones Classical in the Park Bonita Greek Community Center 3010 La Vida, Newport Beach, CA 1PM - 3PM 2026 16 of 20 104 Bonita Greek Community Center 3010 La Vida, Newport Beach, CA 2026 17 of 20 105 Emerald Magic Events September 2026Septembmer2026CLASSICAL MUSICLIVE CONSERTSMAGAZINE Musical Event -live to headphones Classical in the Park Newport Beach Junior Lifeguard Building 901 E. Oceanfront, Newport Beach, CA 1 PM - 3PM 2026 18 of 20 106 Newport Beach Junior Lifeguard Building 901 E. Oceanfront, Newport Beach, CA 2026 19 of 20 107 Emerald Magic Events November 2026Novembmer2026CLASSICAL MUSICLIVE CONSERTSMAGAZINE 2026 The best classical pieces and dances ATOMIC BALLROOM 17961 Sky Park Cir Ste C Irvine, CA 92614 3PM - 6PM20 of 20 108 &&XOWXUDO$UWV*UDQWV$SSOLFDWLRQ)RUP 5HIHUHQFH 6WDWXV &RPSOHWH 3RSXODU1DPHRI2UJDQL]DWLRQ 3DFLILF&KRUDOH /HJDO1DPHLIGLIIHUHQW6DPH )HGHUDO7D[,'1R 0DLOLQJ$GGUHVV +DUERU%OYG6XLWH &LW\=LSFRGH &RVWD0HVD &RQWDFW1DPH -DQLV0RUVH 3KRQHQXPEHU (PDLODGGUHVV JUDQWV#SDFLILFFKRUDOHRUJ :HEVLWH ZZZSDFLILFFKRUDOHRUJ *HRJUDSKLFDO$UHD6HUYHG $XGLHQFHVDQGHGXFDWLRQSURJUDPSDUWLFLSDQWV FRPHIURP2UDQJH/$ 5LYHUVLGH&RXQWLHV 3ULPDU\YHQXHVDUH6HJHUVWURP&HQWHUIRUWKH $UWVLQ&RVWD0HVDDQG6W0DUNಬV3UHVE\WHULDQ DQG2XU/DG\4XHHQRI$QJHOVLQ1HZSRUW %HDFK +DYH\RXUHFHLYHGD&LW\RI1HZSRUW%HDFK &XOWXUDO$UWV*UDQWEHIRUH" <HV ,IVRZKDW\HDUGLG\RXUHFHLYHDJUDQW" <HDURUJDQL]DWLRQZDVIRXQGHG 1XPEHURISDLGVWDII)737 1XPEHURIDFWLYHYROXQWHHUV 7RWDODPRXQWUHTXHVWHGIURPUHTXHVWOLQHRI SURMHFWEXGJHW (VWLPDWHGQXPEHURISHRSOHLQ1HZSRUW%HDFK WKDWWKHSURSRVHGSURMHFWVZLOOVHUYH 1 of 25 ATTACHMENT E 109 3DFLILF&KRUDOHLVD*5$00<$ZDUGದZLQQLQJ HQVHPEOHDQGRQHRIWKHQDWLRQಬVOHDGLQJ SURIHVVLRQDOFKRUDORUJDQL]DWLRQV)RUQHDUO\ \HDUVLWKDVVHUYHGDVDFXOWXUDOFRUQHUVWRQHLQ 2UDQJH&RXQW\HQULFKLQJWKHFRPPXQLW\WKURXJK ZRUOGFODVVSHUIRUPDQFHVQXUWXULQJHPHUJLQJ WDOHQWDQGFKDPSLRQLQJGLYHUVHDUWLVWLF H[SUHVVLRQ2XUPLVVLRQLVWRLQVSLUHXQLWHDQG XSOLIWWKURXJKH[FHSWLRQDOFKRUDOPXVLF$VDFRUH DUWLVWLFSDUWQHURI3DFLILF6\PSKRQ\ZHSHUIRUP UHJXODUO\DWWKH6HJHUVWURP&HQWHUIRUWKH$UWV RIIHULQJHPRWLRQDOO\UHVRQDQWDFFHVVLEOH SURJUDPPLQJWKDWEULQJVSHRSOHWRJHWKHUDQG VWUHQJWKHQVFRPPXQLW\FRQQHFWLRQ 3DFLILF&KRUDOHLVFRPPLWWHGWRIRVWHULQJOLIHORQJ HQJDJHPHQWZLWKWKHDUWV2XUSURJUDPVVSDQ HDUO\FKLOGKRRGPXVLFHGXFDWLRQDGXOW HQULFKPHQWDQGFXUDWHGFXOWXUDOWUDYHOZLWK SODQQHGH[SDQVLRQLQWRLQLWLDWLYHVVXFKDVWKH 3DFLILF&KRUDOH$FDGHP\LQORZLQFRPHSDUWQHU VFKRROVD+LJK6FKRRO&KRUDO)HVWLYDOFROOHJH OHYHOWUDLQLQJZLWK&DO6WDWH)XOOHUWRQD.ದ FKLOGUHQಬVFKRUXVDQGGLYHUVHFRPPXQLW\HYHQWV 7KHVHHIIRUWVFXOWLYDWHFUHDWLYLW\FROODERUDWLRQ DQGFULWLFDOWKLQNLQJVNLOOVHVVHQWLDOIRUWRGD\ಬV HYROYLQJZRUNIRUFH 2XULPSDFWLVEURDGDQGPHDVXUDEOH,Q VHDVRQRXUFRQFHUWVHGXFDWLRQDOSURJUDPVDQG JXHVWDSSHDUDQFHVUHDFKHGPRUHWKDQ SHRSOHDFURVVHYHQWVSURYLGHGKRXUV RIPXVLFHGXFDWLRQLQVFKRROVVHWQHZUHFRUGV ZLWKIRXUVROGRXWKROLGD\FRQFHUWVDFKLHYHGWKH KLJKHVWWLFNHWUHYHQXHLQRXUKLVWRU\DQG UHOHDVHG7RWKH+DQGVRQO\WKHVHFRQGIHDWXUH OHQJWKILOPLQRXUUHSHUWRLUH2XU&KRUDO)HVWLYDO EURXJKWWRJHWKHUFKRULVWHUVIURPWKHDUHD MRLQLQJ3DFLILF&KRUDOHLQFRQFHUW:LWKDJURZLQJ %ULHIO\GHVFULEHEHORZ\RXURUJDQL]DWLRQ V SXUSRVHPLVVLRQDQGJRDOV 2 of 25 110 URVWHURIVLQJHUVDQGGHGLFDWHGDUWLVWLFDQG DGPLQLVWUDWLYHOHDGHUVKLS3DFLILF&KRUDOHLV SRLVHGIRUFRQWLQXHGJURZWKDQGFRPPXQLW\ LPSDFW 3DFLILF&KRUDOHLVZHOOSRVLWLRQHGWRSURYLGHWKH SURSRVHGSURJUDPVDVGHPRQVWUDWHGE\WKH IROORZLQJFRPPXQLW\QHHGVDQGRSSRUWXQLWLHV /LPLWHGDUWVDFFHVVIRU\RXWK 1HZSRUW0HVD8QLILHG6FKRRO'LVWULFWVHUYHV RYHUVWXGHQWV\HWRQO\DIUDFWLRQKDYH DFFHVVWRSURIHVVLRQDOOHYHOSHUIRUPLQJDUWV H[SHULHQFHVZLWKLQ1HZSRUW%HDFK $FFRUGLQJWRWKH&LW\ಬV$UWV &XOWXUDO0DVWHU 3ODQPRUHWKDQRIDUWVSDUWLFLSDWLRQIRUORFDO \RXWKRFFXUVRXWVLGH1HZSRUW%HDFKLQGLFDWLQJ DJDSLQORFDODFFHVV +LJKGHPDQGIRUORFDOFXOWXUDOSURJUDPPLQJ 1HZSRUW%HDFKಬVSRSXODWLRQLVDSSUR[LPDWHO\ EXWWKHFLW\KRVWVIHZHUWKDQDGR]HQ SURIHVVLRQDOOHYHOSHUIRUPLQJDUWVHYHQWV DQQXDOO\ZLWKLQFLW\OLPLWV 6XUYH\VFRQGXFWHGIRUWKH&LW\ಬV$UWV &XOWXUDO 0DVWHU3ODQVKRZWKDWRYHURIUHVLGHQWV ZDQWPRUHOLYHPXVLFDQGFXOWXUDOHYHQWVLQ 1HZSRUW%HDFKHVSHFLDOO\LQDFFHVVLEOH QHLJKERUKRRGYHQXHV (FRQRPLFDQGFRPPXQLW\EHQHILW 1HZSRUW%HDFKDWWUDFWVRYHUPLOOLRQYLVLWRUVSHU \HDU\HWRQO\DVPDOOSHUFHQWDJHHQJDJHZLWK DUWVSURJUDPPLQJGXHWROLPLWHGRIIHULQJV 7KH1DWLRQDO(QGRZPHQWIRUWKH$UWVUHSRUWVWKDW HYHU\GROODULQYHVWHGLQORFDODUWVJHQHUDWHVXSWR LQHFRQRPLFDFWLYLW\UHLQIRUFLQJWKHYDOXHRI H[SDQGLQJFXOWXUDOHYHQWVZLWKLQWKHFLW\ ,GHQWLI\DQGGHVFULEHZK\WKHUHLVDQHHGLQ WKH1HZSRUW%HDFK&RPPXQLW\IRU\RXU SURSRVHGSURMHFWSURJUDP,QFOXGHDTXDQWLWDWLYH GHVFULSWLRQRIWKHQHHGDQGRQZKDW\RXEDVHG \RXUILQGLQJVLHಯ%DVHGRQDVWXG\GRQHE\WKH 37$WKHUHDUHRQHKXQGUHGFKLOGUHQLQWKHWK WKJUDGHVDW1HZSRUW(OHPHQWDU\ZKRKDYHKDG QRWUDLQLQJZLWKPXVLFDOLQVWUXPHQWVರ'HVFULEH KRZ\RXKDYHGHWHUPLQHGWKDW\RXURUJDQL]DWLRQ LVWKHEHVWRUJDQL]DWLRQIRUWKHSURSRVHGSURMHFW SURJUDP 3 of 25 111 *HRJUDSKLFDQGWUDQVSRUWDWLRQEDUULHUV 0RUHWKDQRI1086'VWXGHQWVOLYHPRUH WKDQPLOHVIURP6HJHUVWURP&HQWHUIRUWKH$UWV PDNLQJORFDOQHLJKERUKRRGFRQFHUWVD VLJQLILFDQWO\PRUHDFFHVVLEOHHQWU\SRLQWIRUILUVW WLPHDUWVHQJDJHPHQW 3DFLILF&KRUDOHಬVFKDPEHUFKRLUZLOOSUHVHQW(ULF :KLWDFUHಬV7KH6DFUHG9HLORQ0DUFK DW2XU/DG\4XHHQRI$QJHOV&DWKROLF&KXUFKLQ 1HZSRUW%HDFK7KLVGHHSO\PRYLQJ ZRUNಧFUHDWHGLQFROODERUDWLRQZLWKSRHW&KDUOHV $QWKRQ\6LOYHVWULಧWUDFHVDMRXUQH\RIORYHORVV DQGKHDOLQJWKURXJK:KLWDFUHಬVVLJQDWXUH OXPLQRXVKDUPRQLHV7KHSURJUDPDOVRIHDWXUHV KLVWUDQVFHQGHQW7KUHH6RQJVRI)DLWKRIIHULQJ DXGLHQFHVDSRZHUIXODQGFRQWHPSODWLYHPXVLFDO H[SHULHQFH6HWZLWKLQWKHLQWLPDWHUHVRQDQW DFRXVWLFVRI2XU/DG\4XHHQRI$QJHOVWKLV FRQFHUWLQYLWHVOLVWHQHUVLQWRDQHYHQLQJRI UHIOHFWLRQHPRWLRQDOGHSWKDQGH[WUDRUGLQDU\ FKRUDODUWLVWU\ 'HFHPEHUಬV&DUROVE\&DQGOHOLJKWLVDIDYRULWHRI ORFDOVDQGYLVLWRUVVHHNLQJWKHPRUHUHIOHFWLYH VLGHRIWKHZLQWHUKROLGD\V.QRZQIRULWV EHDXWLIXOO\EDODQFHGSURJUDPPLQJRIWUDGLWLRQDO DQGFRQWHPSRUDU\KROLGD\PXVLFLQDSHDFHIXO FDQGOHOLWVHWWLQJWKLVLQWLPDWHFRQFHUWJLYHVYRLFH WRWKHZRQGHUUHYHUHQFHDQGDZHRIWKH VHDVRQ:LWKDGHYRWHGDQGJURZLQJIDQEDVH ZHH[SHFWWKDWWKLVLPPHUVLYHH[SHULHQFHZLOOVHOO RXWERWKSHUIRUPDQFHV5HFHQWVHDVRQVKDYH DOVRVROGRXWPXOWLSOHSHUIRUPDQFHVZLWK DWWHQGHHVGHVFULELQJWKHH[SHULHQFHDVಯD PRPHQWRISHDFHDQGEHDXW\ರDQGQRWLQJWKH ಯZDUPWKRIFDQGOHOLJKWರDQGಯFROOHFWLYHH[KDOHರ WKDWGHILQHWKLVLQWLPDWHFRQFHUW,WVUHSXWDWLRQDV 'HVFULEHWKHVSHFLILFSURMHFWSURJUDPWKDWZLOO EHIXQGHGE\DFXOWXUDOJUDQW,QFOXGHKRZWKH SURSRVHGSURMHFWSURJUDPZLOOEHLPSOHPHQWHG DQGRXWOLQHDVFKHGXOHRUSURMHFWWLPHOLQHZLWK SODQQHGGDWHVDQGORFDWLRQV,GHQWLI\LQGLYLGXDOV DQGJURXSVLQYROYHGSDUWLFXODUO\DUWLVWVDQG SHUIRUPHUVDQGGHVFULEHWKHLUUROHVDQG UHVSRQVLELOLWLHV'HVFULEHWKHEDFNJURXQGDQG TXDOLILFDWLRQVRI\RXURUJDQL]DWLRQDQGNH\ SHUVRQQHOWREHLQYROYHGLQWKHSURJUDP 5HPHPEHUWKH&LW\IXQGVRQO\SURMHFWVDQG SURJUDPVQRWRSHUDWLQJH[SHQVHV7KHVH SURMHFWVDQGSURJUDPVPXVWSURPRWHFRPPXQLW\ LQYROYHPHQWDQGDZDUHQHVVRIWKHDUWVLQ 1HZSRUW%HDFK 4 of 25 112 DUHIOHFWLYHFRPPXQLW\ತFHQWHUHGKROLGD\ JDWKHULQJFRQWLQXHVWRJURZGUDZLQJERWK ORQJWLPHVXSSRUWHUVDQGQHZOLVWHQHUVVHHNLQJD PHDQLQJIXOVWDUWWRWKHVHDVRQ ,,VWKLVDQHZRUH[LVWLQJSURMHFWSURJUDP"([LVWLQJSURJUDP 'HILQHRUGHVFULEHWKHVHJPHQWRIWKH SRSXODWLRQLQ1HZSRUW%HDFKWKDW\RXLQWHQGWR VHUYHE\\RXUSURMHFWSURJUDP,QFOXGHVXFK WKLQJVDVDJHORFDWLRQQXPEHUVVHUYHGHWF %DVHGRQSDVWWLFNHWVDOHVIRUVLPLODUFRQFHUWV ZHH[SHFWIXOOFDSDFLW\FURZGVRISHRSOHRI DOODJHVIRUHDFKRIWKHWZRSHUIRUPDQFHVRI &DUROVE\&DQGOHOLJKWDQGPRUHWKDQIRU 6DFUHG9HLO([WUDSRODWLQJIURP]LSFRGHDQG SURPRFRGHGDWDIURPSDVWRIIHULQJVDW2XU/DG\ 4XHHQRI$QJHOVZHSUHGLFWWKDWPRUHWKDQKDOI RIDWWHQGHHVZLOOEH1HZSRUW%HDFKUHVLGHQWV DWWUDFWHGWRWKHORFDOYHQXHDQGWKHUHPDLQGHU ZLOOFRPHIURPRWKHUSDUWVRI2UDQJH&RXQW\ZLWK FRQFHQWUDWLRQVLQ,UYLQH/DJXQD%HDFKDQG )XOOHUWRQ8SWRWLFNHWVIRUHDFKSURJUDPZLOO EHRIIHUHGIRUIUHHWRORFDOVFKRROVDQGVRFLDO VHUYLFHDJHQFLHVWRHQVXUHWKDWSULFHLVQRWD EDUULHUWRDFFHVV 352-(&7%8'*(7([SHQVHV3HUVRQQHO $UWLVWLF )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV $GPLQLVWUDWLYH )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 7HFKQLFDO3URGXFWLRQ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 352-(&7%8'*(7([SHQVHV2SHUDWLQJ )DFLOLW\([SHQVH6SDFH5HQWDO 5 of 25 113 ))XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 0DUNHWLQJ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 3URGXFWLRQ([KLELWLRQ([SHQVH )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 7RXULQJ3UHVHQWDWLRQ([SHQVH )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV (GXFDWLRQ0DWHULDOV )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 7UDQVSRUWDWLRQ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV (TXLSPHQW )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 2WKHULIJUHDWHUWKDQDQQRWDWHEHORZ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV *5$1'727$/UHTXHVWEXGJHW 'HVFULEHWKHH[SHFWHGTXDQWLILDEOHRXWFRPHV RI\RXUSURMHFWSURJUDPDQGKRZ\RXZLOO HYDOXDWHWKHUHVXOWV%HYHU\VSHFLILFLQ DGGUHVVLQJWKHZD\VWKDW\RXZLOOGHWHUPLQHWKDW 3DFLILF&KRUDOHZLOOKROGHOHYHQUHKHDUVDOVDW6W 0DUNಬV3UHVE\WHULDQ&KXUFKDQGIRXUUHKHDUVDOV SOXVWZRSHUIRUPDQFHVDW2XU/DG\4XHHQRI $QJHOV%RWKORFDWLRQVDUHLQ1HZSRUW%HDFK 6 of 25 114 \\RXUSURMHFWSURJUDPPHWWKHQHHGVWKDW\RX LGHQWLILHGDQGDFFRPSOLVKHVWKHJRDOV\RXVHWRXW WRDFKLHYHLH\RXSURYLGHKRXUVRIPXVLFDO LQVWUXFWLRQDQGLQVWUXPHQWVWRWKHFKLOGUHQDW 1HZSRUW(OHPHQWDU\VFKRRODVPHDVXUHGE\ PXVLFVWRUHUHQWDOUHFHLSWVDQGORJVRI LQVWUXFWRUV &RQFHUWVZLOOEHDWWHQGHGE\DQHVWLPDWHGWRWDO DXGLHQFHRIOLVWHQHUVDVPHDVXUHGE\ WLFNHWVDOHV:HZLOORIIHUXSWRIUHHWLFNHWVWR 1HZSRUW%HDFKFKRLUVWXGHQWVIDPLOLHVDQG VRFLDOVHUYLFHSDUWQHUVWRHQVXUHWKDWFRVWLV QHYHUDEDUULHUWRFRQFHUWDWWHQGDQFH /LVWRI%RDUG0HPEHUVDQGWKHLUDIILOLDWLRQV 5HFHQWOLVWRILQGLYLGXDOVFRUSRUDWLRQVDQG IRXQGDWLRQVWKDWSURYLGHRUJDQL]DWLRQDOVXSSRUW ,56'HWHUPLQDWLRQ/HWWHULI\RXDUHD FbLQGLFDWLQJWD[H[HPSWVWDWXV 2QHEURFKXUHDQGRURQHSUHVVFOLSSLQJ , ,QFRPHFDVKRQO\ &RQWULEXWHG )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG (DUQHG )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 7RWDO,QFRPH )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG ,, ([SHQVHV 3URJUDP )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG *HQHUDODQG$GPLQLVWUDWLYH Document found on page 10. Document found on pages 11-12. Document found on page 13. Document found on pages 14-35. 7 of 25 115 ))<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG 0DUNHWLQJJDQGG'HYHORSPHQW )<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG 7RWDOO([SHQVHV )<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG ,WHPP ,,, 2SHUDWLQJJ6XUSOXV'HILFLWW,QFRPHHPLQXVV([SHQVHV )<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG ,9 )XQGG%DODQFHHDWW%HJLQQLQJJRII<HDU )<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG 9 $FFXPXODWHGG6XUSOXVV'HILFLW$GGGOLQHVV,,,,DQGG,9 )<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG ,WHPP 9, ,Q.LQGG&RQWULEXWLRQVVDWWDFKKVFKHGXOHVVLIIJUHDWHUUWKDQQRIIWRWDOOLQFRPH )<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG ,,YHULI\\WKHHNQRZOHGJHHWKDWWWKHHLQIRUPDWLRQQ VXEPLWWHGGLQQWKLVVDSSOLFDWLRQQLVVWUXHHDQGGFRUUHFWWWRR WKHHEHVWWRIIP\\NQRZOHGJH 1DPH -DQLV0RUVH 7LWOH *UDQWV0DQDJHU 8 of 25 116 //DVW8SGDWH 6WDUW7LPH )LQLVK7LPH 3RZHUHGE\)RUPVLWH9 of 25 117 Board of Directors 2025 Last Name First Name Position (*Exec Committee)Affiliation Andrews Mike Director Extron Baker Jennifer Director Bates Brian Treasurer*Bates & Company, Inc. Del Campo Rhett President & CEO*Pacific Chorale Hall-Brown Maria Director PBS SoCal Istad Rob Artistic Director Pacific Chorale Lindley Chris Director LHF Brands Lindley Susan Secretary*Capital Group (ret.) Lyons Mary Chair Emeritus* Nordrum Samuel Director Segerstrom Center for the Arts O'Hern Marcía Director Pridonoff Tom Director Dacha Enterprises Pulice Owens Ann Director PBS SoCal (ret.) Quinn Stephane Director Quinn & Dworakowski, LLP Ratcliff Ryan Artists' Council Rep HPI Architecture Springer Craig Immediate Past Chair*Irvine Barclay Theatre Vantrease Michael Director Legacy Bank Virjee Julie Chair*Yambi Rwanda Whiting Amanda Vice Chair*Capital Group Zhang Charlie Director Zion Enterprises 10 of 25 118 Sources of Funding During Grant Period $5,000 - $100,000 Provided with Report to the City of Newport Beach - 1/12/26 Further information is available as needed. DONOR INDIVIDUAL (I), FOUNDATION (F), GOVERNMENT (G,) CORPORATE (C) $100,000+ Phillip N. and Mary A. Lyons I Lenora Meister & Salt-Away Products, Inc. C Ron Rudderow I $25,000+ Karl and Marilyn Forsstrom I Hans and Valerie Imhof I John and Lori Loftus I David and Darrellyn Melilli I Trish O’Donnell I Charles and Ling Zhang I $10,000+ Janice Johnson I James and Karen McBride I Haydee Mollura I 11 of 25 119 Kenneth and Carla Neeld I Thomas and Bonnie PridonoƯ I Loraine Reed I $5,000+ Mike Andrews I Brian D. Bates, CPA C Mary Ester Blakley I John and Marcia Cashion I Margaret Gates I Kathryn Gibson I Mark and Donna Hoover I Mei Yen Huang Chang I Lon V Smith Foundation F We are deeply grateful for the generous supporters at all levels who make our work possible. We extend our sincere appreciation to the City of Newport Beach for its partnership and ongoing engagement. It is an honor to partner with you! 12 of 25 120 13 of 25 121 Bu y y o u r t i c k e t s t o d a y a t pa c i f i c c h o r a l e . o r g (7 1 4 ) 6 6 2 - 2 3 4 5 TIC K E T S FR O M $3 3 CA R O L S B Y C A N D L E L I G H T SA T U R D A Y , D E C E M B E R 6 , 2 0 2 5 A T 8 : 0 0 P M WE D N E S D A Y , D E C E M B E R 1 0 , 2 0 2 5 A T 8 : 0 0 P M Ou r L a d y Q u e e n o f A n g e l s C a t h o l i c C h u r c h 21 0 0 M a r V i s t a D r i v e , N e w p o r t B e a c h 14 of 25 122 33 0 3 H a r b o r B l v d . , S u i t e E 5 Co s t a M e s a , C A 9 2 6 2 6 Ca r o l s b y Ca n d l e l i g h t FE A T U R I N G Me m b e r s o f Pa c i f i c C h o r a l e Ro b e r t I s t a d , CO N D U C T O R WIT H Da v i d C l e m e n s e n , PI A N O Ju n g - A L e e , OR G A N Or d e r t i c k e t s t o d a y ! pa c i f i c c h o r a l e . o r g (7 1 4 ) 6 6 2 - 2 3 4 5 PR O G R A M H I G H L I G H T S I N C L U D E Jo y t o t h e W o r l d ! Ia n C r a w f o r d Aw a y i n a M a n g e r Ola G j e i l o In f a n t H o l y , I n f a n t L o w l y Ry a n J a m e s B r a n d a u Su s s e x C a r o l E l a i n e H a g e n b e r g SI N G - A L O N G S : Th e F i r s t N o w e l l arr . D a v i d W i l l c o c k s O L i t t l e T o w n o f B e t h l e h e m Le w i s R e d n e r , d e s c a n t b y R u t t e r Si l e n t N i g h t a r r . B o b C h i l c o t t My L o r d H a s C o m e W i l l T o d d In D u l c i J u b i l o M a t t h e w C u l l o t o n We W i s h Y o u a M e r r y C h r i s t m a s arr . P a u l J o h n s o n AN D M A N Y M O R E ! PL A T I N U M S E A S O N S P O N S O R : Ph i l l i p N . a n d M a r y A . L y o n s CO N C E R T S P O N S O R S : Ma r c ì a a n d D e n n i s O ’ H e r n TIC K E T S FR O M $3 3 SA T , D E C E M B E R 6 , 2 0 2 5 A T 8 : 0 0 P M WE D , D E C E M B E R 1 0 , 2 0 2 5 A T 8 : 0 0 P M Ce l e b r a t e t h e s e a s o n w i t h t h e a n g e l i c v o i c e s an d g l o w i n g h a r m o n i e s o f P a c i f i c C h o r a l e . An e n c h a n t i n g e v e n i n g o f t i m e l e s s c a r o l s , co n t e m p o r a r y f a v o r i t e s , a n d j o y f u l s i n g - al o n g s l e d b y A r t i s t i c D i r e c t o r R o b e r t I s t a d an d p e r f o r m e d b y o u r c h a m b e r c h o i r . W i t h mu s i c t h a t w a r m s t h e h e a r t a n d l i f t s t h e sp i r i t , i t ’ s t h e p e r f e c t h o l i d a y e x p e r i e n c e t o ki c k o f f t h e C h r i s t m a s s e a s o n . Se c u r e y o u r t i c k e t s t o d a y a n d m a k e Ca r o l s by C a n d l e l i g h t a t r e a s u r e d p a r t o f y o u r ho l i d a y c e l e b r a t i o n . 15 of 25 123 Our Lady Queen of Angels Catholic ChurchNewport Beach Pacifi c Chorale Robert Istad, ARTISTIC DIRECTOR & CONDUCTOR Kibsaim Escárcega, ASSISTANT CONDUCTOR Jung-A Lee, ORGAN David Clemensen, PIANO 2025-26 SEASON SATURDAY DECEMBER 6, 2025 8:00PM WEDNESDAY DECEMBER 10, 2025 8:00PM CAROLS BY CANDLELIGHT Platinum Season Sponsor Phillip N. and Mary A. Lyons Concert Sponsor Dennis and Marcía O’Hern 16 of 25 124 ROBERT ISTAD, a GRAMMY® Award-winning conductor who “fashions fluent and sumptuous readings” (Voice of OC) with his “phenomenal” artistry (Los Angeles Times), was appointed Pacific Chorale’s Artistic Director in 2017. Under his leadership, the chorus continues to expand its reputation for excellence for delivering fresh, thought- provoking interpretations of beloved masterworks, rarely performed gems and newly commissioned pieces. His artistic impact can be heard on two recent recordings featuring Pacific Chorale, including the 2020 Grammy Award-winning “Mahler’s Eighth Symphony” with the Los Angeles Philharmonic Orchestra conducted by Gustavo Dudamel on Deutsche Grammophon (2021), for which he prepared the chorus. It won Best Choral Performance and also garnered a Grammy nomination for Best Engineered Album, Classical. Additionally, Istad conducted the Pacific Chorale’s recording “All Things Common: The Music of Tarik O’Regan” released on Yarlung Records (2020). Istad has prepared choruses for such renowned conductors as Esa-Pekka Salonen, John Williams, John Mauceri, Keith Lockhart, Nicholas McGegan, Vasilly Sinaisky, Sir Andrew Davis, Bramwell Tovey, Carl St.Clair, Eugene Kohn, Giancarlo Guerrero, Marin Alsop, George Fenton, and Robert Moody. He regularly conducts and collaborates with Pacific Symphony, Musica Angelica Baroque Orchestra, Sony Classical Records, Yarlung Records, Berkshire Choral International, and Long Beach Symphony Orchestra. An esteemed educator, Istad is Professor of Music and Director of Choral Studies at California State University, Fullerton, where he was recognized as CSUF’s 2016 Outstanding Professor of the Year. He conducts the University Singers and manages a large graduate conducting program, in addition to teaching courses on conducting and performance practice. Istad, who is on the Executive Board of Directors of Chorus America and serves as Dean of Chorus America’s Conducting Academy, is in demand as guest conductor, lecturer, and clinician. ROBERT ISTAD PHILLIP N. AND MARY A. LYONS ARTISTIC DIRECTOR CHAIR 10 PACIFIC CHORALE 17 of 25 125 The GRAMMY® Award-winning PACIFIC CHORALE, an Orange County “treasure” with a “fresh viewpoint” that “can sing anything you put in front of it with polish, poise and tonal splendor” (Orange County Register), has “risen to national prominence” (Los Angeles Times) since its inception in 1968. Hailed for delivering “thrilling entertainment” (Voice of OC), the resident choir at Segerstrom Center for the Arts is noted for its artistic innovation and commitment to expanding the choral repertoire. It has given world, U.S., and West Coast premieres of more than 40 works, including numerous commissions, by such lauded composers as John Adams, Jake Heggie, James Hopkins, David Lang, Morten Lauridsen, Tarik O’Regan, Karen Thomas, Frank Ticheli, András Gábor Virágh, and Eric Whitacre. In addition to presenting its own concert series each season, Pacific Chorale, led by Artistic Director Robert Istad, enjoys a long- standing partnership with Pacific Symphony, with which the choir made its highly anticipated Carnegie Hall debut in 2018. The chorus also regularly appears with the Los Angeles Philharmonic, with which it won the 2022 GRAMMY® Award for Best Choral Performance for its contribution to the live recording of “Mahler: Symphony No. 8, ‘Symphony of A Thousand,’” conducted by Gustavo Dudamel, featuring Los Angeles Philharmonic, Los Angeles Children’s Chorus, Los Angeles Master Chorale, National Children’s Chorus and Pacific Chorale. The choir has performed with such leading orchestras as the Boston Symphony, National Symphony, Los Angeles Chamber Orchestra, Philharmonia Baroque Orchestra, San Diego Symphony, and Musica Angelica, among others. In addition to receiving national accolades, Pacific Chorale has garnered tremendous international acclaim. In July 2023, the chorus completed its first international tour in seven years with appearances in Austria, Germany and the United Kingdom in collaboration with Bath Philharmonia, Free State Orchestra of Bavaria, and Bournemouth Symphony Chorus and Orchestra. Previous tours have taken the choir to 19 countries in Europe, South America, and Asia, including engagements with the London Symphony, Munich Symphony, L’Orchestre Lamoureux and L’Orchestre de St-Louis-en-l’Île of Paris, National Orchestra of Belgium, China National Symphony, Hong Kong Sinfonietta, Estonian National Symphony, and Orquesta Sinfonica Nacional of Argentina, among others. Deeply committed to making choral music accessible to everyone, the organization has a discography of 14 self-produced recordings and an extensive collection of free digital offerings. Recently, Pacific Chorale’s one hour choral-theatrical film To the Hands was featured as an Official Selection at the Newport Beach Film Festival, San Pedro International Film Festival, and the Culver City Film Festival. Pacific Chorale also places significant emphasis on choral music education, providing after-school vocal programs for elementary school students, a choral summer camp for high school students, and an annual community-wide singing event at Segerstrom Center for the Arts. www.pacificchorale.org PACIFIC CHORALE PACIFIC CHORALE 11 18 of 25 126 Robert Istad, PHILLIP N. AND MARY A. LYONS ARTISTIC DIRECTOR CHAIR John Alexander, ARTISTIC DIRECTOR EMERITUS Kibsaim Escárcega, ASSISTANT CONDUCTOR RON RUDDEROW LEGACY CHAIR PACIFIC CHORALE SOPRANO Rebecca Hasquet, SECTION LEADER Alexandria Burdick Chelsea Chaves Jenna Hansen Maria Cristina Navarro Joslyn Sarshad ALTO Jane Hyun-Jung Shim, SECTION LEADER Emily Border Denean R. Dyson 15 I-Chin Betty Feinblatt Stephanie Shepson Rachel Steinke TENOR Alan Garcia, ACTING SECTION LEADER Nate Brown Jason Francisco Johnny Gonzales Bryce Rivera Sammy Salvador, RON GRAY LEGACY CHAIR BASS Ryan Thomas Antal, SECTION LEADER RON GRAY LEGACY CHAIR Michael Fagerstedt Matthew Kellaway Jason Pano Raphael Poon Ian Schipper KIBSAIM ESCÁRCEGA serves as Assistant Conductor for the GRAMMY® Award-winning Pacific Chorale. Born and raised in Southern California, he is an active presence in the choral community as a conductor, teacher, and singer. Escárcega holds degrees in Vocal Performance and Choral Conducting from the University of California, Irvine, and California State University, Fullerton. He studied voice under Dr. Darryl Taylor and Dubravka Zubovic, and conducting with Seth Houston, Stephen Tucker, Robert Istad, and Kimo Furumoto. At UC Irvine, Escárcega conducted the student-led BATS Choir, served as Assistant Conductor for the Chamber Singers and Concert Choir, and was Chorus Master for various UCI opera productions. During his graduate studies at CSUF, he held the position of Graduate Assistant Conductor for Titan Voices, Concert Choir, Opera Theatre, and University Singers, conducting numerous concerts and preparing choruses and instrumental ensembles for opera productions. Escárcega has also served as Chorus Master for Lyric Opera of Orange County, the region’s professional opera company, and has prepared choirs for distinguished international conductors in renowned venues, including the Segerstrom Concert Hall and the Hollywood Bowl. His work has extended to significant public events, such as preparing choirs for memorial services, underscoring the role of music in bringing communities together. DR. JUNG-A LEE has performed in Europe, North America, Asia and Africa as an organist, pianist, harpsichordist, and conductor. She currently serves as organist at St. Andrew’s Presbyterian Church in Newport Beach, California, and sub-dean of The American Guild of Organists Orange County Chapter. Lee is also on the faculty of Biola University and Vanguard University. In 2009 Lee founded Music Mission International to promote classical music focusing on organ. Since 2018 she has played with David Chang (clarinet) and Cynthia Ellis (flute) as Synergy Trio. In addition, she works for Pacific Chorale and Pacific Symphony as keyboardist. Lee has given solo organ recitals in venues including the Cadet Chapel at the United States Military Academy in West Point, New York; St. Thomas’ Episcopal Church in New York; Woolsey Hall at Yale University; The Memorial Church and Rudolph Busch Hall at Harvard University; Washington National Cathedral in Washington, DC; Methuen Music Hall in Massachusetts; Grace Cathedral in San Francisco; Renée and Henry Segerstrom Hall in Costa Mesa; Crystal Cathedral (now Christ Cathedral) in Garden Grove; the Cathedral of Our Lady of the Angels in Los Angeles; and the First Congregational Church of Los Angeles. She completed a Doctor of Musical Arts degree in organ performance from Boston University. She served as an organ scholar of The Memorial Church, Harvard University from 2001 to 2003. Lee earned her Master of Music 12 PACIFIC CHORALE 19 of 25 127 degree in organ performance from Yale University with a full scholarship and worked as a collaborative pianist for the Opera School at Yale, receiving numerous prizes including the Charles Ives Prize. Her teachers include Thomas Murray, Martin Jean, Gerre Hancock, John Tuttle, Karl Hochreither, Michael Bloss, William Wright and Lori Loftus. She has also participated in master classes with Olivier Latry, Marilyn Keiser and Susan Landale. Lee has worked with many fine conductors including Christopher Hogwood, Doreen Rao, Carl St.Clair, John Alexander, Robert Istad, Bramwell Tovey, Murray Somerville, James Melton, Joseph Huszti, Chai-Hoon Park and Locky Chung. Lee can be heard as organist on Rorem: Works for Choir and Organ/Harvard University Choir (Black Box 1102), on the recordings of the Men in Blaque of UC Irvine, and the recordings of the Concert Choir of Vanguard University of Southern California. Music Mission International’s first DVD, Beauty in the Wind, was released in 2010, from which several pieces were broadcast on the radio program Pipedreams, hosted by Michael Barone. Her 2012 recording Precious Lord includes numerous hymn arrangements and features David Washburn (trumpet), Valerie Geller (violin), and Lori Loftus (piano). In 2013 she was also featured at KUSC, 91.5 FM MHz, South Carolina ETV and Kookdong Korean Christian Radio. In 2014 her 90-minute organ solo recital was broadcast at KVPR, 89.3 FM. Her CD, Amazing Grace was recorded at Walt Disney Concert Hall in Los Angeles on the organ built by Rosales/Glatter-Götz. In 2018 her CD recorded at Walt Disney Concert Hall was released by Grammy Award winning Yarlung Records. www.musicmissioninternational.org DAVID CLEMENSEN is active as a pianist, teacher, church musician and composer. A native Californian, he holds degrees from Chapman University, CSU Fullerton, and the Doctorate of Musical Arts in collaborative piano from USC. 2025-2026 marks his 23rd season as pianist for Pacific Chorale. He may be heard on several of Pacific Chorale’s recordings, including American Voices and The Radio Hour: Choral Music of Jake Heggie. He is in demand throughout Southern California as a collaborator and coach. Dr. Clemensen has taught at Biola University and Fullerton College, and maintains a private studio as an accompanist and teacher. Often called upon to lead music for events of the C. S. Lewis Foundation, he directed the Service of Dedication for the Study Center at Lewis’ home, the Kilns, at the Sheldonian Theatre in Oxford, England. A lifelong church musician, he is Director of Music at Westminster Presbyterian Church in Ontario. His compositions have been performed by many choirs throughout the U.S, and he won the American Orff-Schulwerk competition for his William Blake setting The Tyger and the Lamb. PACIFIC CHORALE 13 Visit pacificchorale.org/carols-by-candlelight for more information about this evening’s soloists! 20 of 25 128 12 PACIFIC CHORALE TICKETS AVAILABLE NOW! AT THE RENÉE AND HENRY SEGERSTROM CONCERT HALL Tis the Season! DECEMBER 21, 2025 AT 5 PM DECEMBER 22, 2025 AT 7 PM Pacific Chorale’s holiday extravaganza lights up the stage with seasonal classics, whimsical surprises, and Santa himself! A Serenade to Music Conducted by Artistic Director Emeritus John Alexander MAY 23, 2026 John Alexander returns to conduct Pacific Chorale and Pacific Symphony in works by Brahms, Boulanger, Bruckner, Heggie, Mozart, Ticheli and Vaughan Williams. AT OUR LADY QUEEN OF ANGELS Whitacre’s The Sacred Veil SATURDAY, MARCH 21, 2026 AT 8PM Pacific Chorale’s chamber choir brings Eric Whitacre’s The Sacred Veil to life—a deeply moving meditation on love, loss, and healing—paired with his transcendent Three Songs of Faith. PACIFIC CHORALE’S 2025-26 CONCERT SEASON PLATINUM SEASON SPONSOR: Phillip N. and Mary A. Lyons CORPORATE SEASON SPONSOR: The Capital Group (714) 662-2345 Pacifi cChorale.org 14 PACIFIC CHORALE LIMITED AVAILABILITY! 21 of 25 129 PACIFIC CHORALE DONORS Pacific Chorale gratefully acknowledges the following donors for their generous contributions since September 2024. These contributions enable Pacific Chorale to continue serving the community with performances of the highest artistic quality, and providing exceptional educational programs designed to continue the tradition of choral artistry in Orange County. $100,000 AND ABOVE Phillip N. and Mary A. Lyons 쁧 Lenora Meister 쁧 and Salt-Away Products, Inc George H.I. Reiss* 쁧 Ron Rudderrow* 쁧 $25,000 TO $99,999 Karl and Marilyn Forsstrom 쁧 Hans and Valerie Imhof John and Lori Loftus 쁧 David and Darrellyn Melilli 쁧 Trish O’Donnell* Dennis and Marcía O’Hern $10,000 TO $24,999 Mary Ester Blakley 쁧 Janice Johnson Jan Landstrom 쁧 James and Karen* McBride 쁧 Haydee Mollura Thomas A. and Bonnie J. Pridonoff 쁧 $5,000 TO $9,999 Mike Andrews 쁧 Anonymous (1) Margaret Gates Kathryn Gibson 쁧 Norm and Sandy Johnson Kenneth and Carla Neeld 쁧 Pat and Craig Newton 쁧 Loraine Reed 쁧 Karen Zfaty $2,500 TO $4,999 Tom and Anne Henley 쁧 Diana Hensley Chris and Susan Lindley 쁧 Stephane Quinn Kirsten and Craig Springer Dr. Deborah Then and Prof. George Foster Fram and Julie Virjee Peter and Martha Wetzel 쁧 $1,000 TO $2,499 John Alexander 쁧 Brien Amspoker and Ellen Breitman Steve and Jennifer Baker 쁧 Brian D. Bates, CPA David L. Bates Margaret and Kenneth Blair John and Marcia Cashion Rhett M. Del Campo and Elena Madrigal Hall Michael and Cheryl Del Campo Peter Foley Rhona Weinberg Gewelber and Hali Lieb Loren and Birgitta Glassen 쁧 Peter Hahn 쁧 Robert Istad and David Istad Navarro 쁧 Drew and Katherine Jacobs Eileen Jeanette Barbara Kingsbury 쁧 Nels and Andrea Klyver 쁧 Jonathan Krauss 쁧 Nancy Lyons Dr. Goran S. Matijasevic John and Elaine McClintic Dr. William C. and Lynn McMaster Drs. John Mooney and Angela Tripoli Robert and Christie Narver Joan S. Petty Judith Posnikoff P. A. Sefton Carol Smith Diane Stovall Dr. Lauri D. Thrupp Amanda and Andrew Whiting Charles and Ling Zhang $500 TO $999 Mark E. Aldrich and Doug Deimeke 쁧 David and Kirsten Bartholomew Art and Donna Carter Mikki Cichocki Matt and Chris Darling Judi Elterman 쁧 GIFTS OF DISTINCTION We gratefully acknowledge the following donors, whose total gifts exceed $1 million, for their exceptional generosity and commitment to the success of the nationally recognized Pacific Chorale. William J. Gillespie Phillip N. and Mary A. Lyons 쁧 Lenora Meister 쁧 PACIFIC CHORALE 17 22 of 25 130 Dr. Robert and Christine Emmons Rosemary P. Fennell DeAnn Forbes James and Sharon Givens Michael and Janet Hards Carol and William Hatton Drs. John and Patricia Lamb Deb Matsumoto Richard Messenger 쁧 Dr. John and Deborah Middlebrooks 쁧 Alexander Nelson Dr. Andrei Novac and Dr. Bonita Jaros 쁧 Karyn Rashoff Ryan Ratcliff 쁧 Kathryn Ryan Dr. Robert M. Stroup $100 TO $499 Dr. Kevork Abazajian and Dr. Charis Kubrin Jay Aber Dennis Aigner and Camille Bertolet Frank and Karen Albers Anonymous (3) Joyce Anne Antal 쁧 Douglas and Catherine Antone Deborah and Jim Babcock Carl and Regina Blankenhorn Andrew and Michelle Brouwer Leonard and Susie Buchan Mary A. Caputi Joe and Barbara Chamberlain Joseph and Julie Chien Denise B. Chilcote Ronald Clark Terry and Phyllis Clark 쁧 C. Leonard Coduti 쁧 Sandra Cupp Lucy Dunn 쁧 Janet Emery Phil and Jan Enns 쁧 Harvey and Sharon Fair 쁧 Drs. Herb and Cheryl Fischer John Forsyte and Michele Moe-Forsyte Larry Gates 쁧 Nancy Gerhard 쁧 William and Alison Gregg William D. and Bonnie Brittain Hall 쁧 Ron and Susan Harvey Catherine Henley-Erickson Daniel and Elizabeth Hoffmann Wendy Isbell Lynne and Mike Istad Manuel Jimenez Barbara Johnson Steven Kaplan Craig and Deborah Kistler 쁧 James and Lidia Klingler Walter and Nancy Lawson Dr. Jung-A Lee Jin Ming Liao 쁧 Laura Long Claudia Looney Amira Mansour Dale and Sally Marquis Herbert and Joyce Miller Douglas and Kimberly Nason 쁧 Thomas Neeld Tricia Nichols Samuel Nordrum Natalie Oswald Ann Peralta Sandy Possehl Dorcas Preston 쁧 Donald Rabe Jerome and Mary Reinhart Mary C. Schiendler Justus and Elizabeth Schlichting Stan Sholik and Linda Wells Sholik 쁧 Wendy Sobeski Peter and Mary Tennyson Gary and Marjie Toops Christopher Tower and Robert Celio Daniel R. Tremblay and Linda L. Kirchner Matthew and Terri Wedell Joshua Wentlandt and Eleen Hsu-Wentlandt 쁧 Wayne D. White Susie Xie Mr. and Mrs. Richard Zevnik 쁧Pacifi c Chorale Member or Alumni *deceased GOVERNMENT, CORPORATE & FOUNDATION SUPPORT $25,000 AND ABOVE The Capital Group Colburn Foundation Pacifi c Life Foundation Salt-Away Products, Inc Segerstrom Center for the Arts $5,000 TO $24,999 Farmers & Merchants Bank Lon V. Smith Foundation National Endowment for the Arts The Renee Jeffrey O’Hern Foundation Robert & Doreen Marshall Fund of the Orange County Community Foundation $1,000 TO $4,999 American Feel Young Chorus City of Costa Mesa LPL Financial Newport Beach Cultural Arts Commission Parker Hannifi n Corp. $100 TO $999 The Kroger Co. Marathon Petroleum Company Very special care has been given to the preparation of donor listings. This list is current as of November 6, 2025. We deeply regret any errors and omissions, and appreciate your phone call to Pacifi c Chorale at (714) 662-2345 or email to ContactUs@Pacifi cChorale.org with needed corrections. 18 PACIFIC CHORALE 23 of 25 131 PACIFIC CHORALE 19 ENDOWMENT FUND Contributions to Pacific Chorale’s Endowment Fund are invested in perpetuity. The interest generated from the Endowment helps to provide the Chorale with long-term financial stability. The Chorale is delighted to acknowledge its generous Endowment Fund donors. We are deeply grateful to them for their belief and investment in the organization’s future. COMMITMENTS OF $1,000,000+ William J. Gillespie* Lori and John Loftus Phillip N. and Mary A. Lyons, Artistic Director Chair COMMITMENTS OF $100,000 & UP Kathryn Gibson Ron Gray* James and Karen* McBride George H. I. Reiss* Ron Rudderow* Assistant Conductor Chair Vina and Barry Williams* COMMITMENTS OF $50,000 & UP Mike Andrews Janice Johnson in memory of Roger W. Johnson John* and Jan Landstrom David and Darrellyn Melilli John and Elizabeth Stahr* COMMITMENTS OF $25,000 & UP Marilyn and Tom Nielsen COMMITMENTS OF $10,000 & UP Wells Fargo Bank Greg and MarJane* Christofferson Dr. Edward and Mrs. Helen Shanbrom* in memory of David Lee Shanbrom COMMITMENTS OF $5,000 & UP Anne B. Nutt COMMITMENTS OF $1,000 & UP Michael Carroll Dr. James* and Yuko Kawai Dunning Margaret Gates Michael and Eleanor* Gordon Dennis V. Menke Richard Messenger Richard McNeil Jeanette Moon Donna Morse Carl and Susan St.Clair in celebration of Cole Carsan St.Clair LEGACY SOCIETY The Legacy Society recognizes and honors those who have included Pacific Chorale as part of their estate planning. Pacific Chorale gratefully acknowledges the following benefactors for their visionary support, ensuring the preservation of quality choral music and education. Mark E. Aldrich John Alexander Mike Andrews Joan Sue Betson* Robert D. Breton Percy Brotherton* Dr. and Mrs. Thomas C. Campbell Phyllis and Terry Clark Warren Coy Denean R. Dyson Jacline R. Evered Roger and Geri Gibb* Kathryn Gibson Gary Good and Jacqueline Charnley Ron Gray* George W. Haas* George Hatchard* William and Carol Hatton Tom and Anne Henley Mark and Donna Hoover Dennis L. Houser Michael and Susan Jacobs Bonita Jaros and Andrei Novac Janice Johnson Barbara Kingsbury Craig and Deborah Kistler John* and Jan Landstrom Randi W. Larsen Chris and Susan Lindley John and Lori Loftus Phillip N. and Mary A. Lyons Karen M.* and James S. McBride Richard Messenger Jeanette Moon Thomas C. Moore Trust* Ann and Steve Morris Betsy* and Jerry Moulton Carla and Kenneth Neeld Patricia Newton Trish O’Donnell* Elizabeth Pearson* Sandy and Val Policky Thomas A. and Bonnie J. Pridonoff Loraine Reed George H. I. Reiss* Ron Rudderow* Peggy Schmid Jane Shepherd Kirsten and Craig Springer Susan Van Wig Martha and Peter Wetzel Vina Williams* If you have already remembered Pacific Chorale in your estate plan, or are interested in doing so, please contact us at (714) 662-2345. All inquiries will be strictly confidential. * deceased LEARN HOW YOU CAN HELP Very special care has been given to the preparation of donor listings. This list is current as of November 6, 2025. We deeply regret any errors and omissions, and appreciate your phone call to Pacific Chorale at (714) 662-2345 or email to ContactUs@PacificChorale.org with needed corrections. Thank you for your support of Pacific Chorale. 24 of 25 132 PACIFIC CHORALE BOARD OF DIRECTORS Julie Virjee BOARD CHAIR Executive Committee Rhett M. Del Campo PRESIDENT & CEO Amanda Whiting VICE CHAIR Susan Lindley SECRETARY Brian D. Bates, CPA TREASURER Mary A. Lyons Craig Springer IMMEDIATE PAST CHAIR Mike Andrews Jennifer M. Baker Maria Hall-Brown Christopher Lindley Samuel Nordrum Marcía O’Hern Ann Pulice Owens Thomas A. Pridonoff Stephane Quinn Ryan Ratcliff ARTISTS’ COUNCIL REPRESENTATIVE Michael Vantrease Charles Zhang Distinguished Emeritus Directors Mary A. Lyons, CHAIR EMERITUS Michael J. Carroll Stanley Cochran Bonnie Brittain Hall Janice M. Johnson Karen Johnson Jan Landstrom Marcus Lussier Thomas H. Nielsen Anne B. Nutt George H. I. Reiss* PACIFIC CHORALE PERSONNEL Rhett M. Del Campo PRESIDENT & CEO Robert Istad ARTISTIC DIRECTOR & CONDUCTOR John Alexander ARTISTIC DIRECTOR EMERITUS Administration Alex Nelson VICE PRESIDENT, ARTISTIC PRODUCTION & OPERATIONS Ryan McSweeney DIRECTOR OF PATRON SERVICES Natalie Hunter DIRECTOR OF MARKETING Natalie Oswald ASSOCIATE DIRECTOR OF DEVELOPMENT Elizabeth Provencio EDUCATION PROGRAM MANAGER Amy Henderson FINANCE & ADMINISTRATION MANAGER Janis Morse GRANTS MANAGER Scarlet Baker COMMUNICATIONS & OFFICE LIAISON Artistic Staff Kibsaim Escárcega ASSISTANT CONDUCTOR David Clemensen, DMA COLLABORATIVE PIANIST Rebecca Hasquet SOPRANO SECTION LEADER Jane Hyun-Jung Shim ALTO SECTION LEADER Nicholas Preston TENOR SECTION LEADER Ryan Thomas Antal BASS SECTION LEADER Ryan Koo TEACHING ARTIST Robert Brader ACADEMY PIANIST Bob Gunn ACADEMY PIANIST Tomás Kacˇo ACADEMY PIANIST Volunteer Administration Barbara Kingsbury HISTORIAN Ryan Ratcliff ARTISTS’ COUNCIL PRESIDENT Consultants & Support www.Pacifi cChorale.org MISSION STATEMENT We inspire our community through artistry and innovation in choral music performances and education programs. PACIFIC CHORALE 3303 Harbor Blvd., Suite E5 Costa Mesa, CA 92626 (714) 662-2345 ContactUs@Pacifi cChorale.org Pacifi c Chorale is a member of Arts Orange County and Chorus America. 20 PACIFIC CHORALE 25 of 25 133 &&XOWXUDO$UWV*UDQWV$SSOLFDWLRQ)RUP 5HIHUHQFH 6WDWXV &RPSOHWH /RJLQ8VHUQDPH OFDULDJH#SDFLILFV\PSKRQ\RUJ /RJLQ(PDLO OFDULDJH#SDFLILFV\PSKRQ\RUJ 3RSXODU1DPHRI2UJDQL]DWLRQ 3DFLILF6\PSKRQ\ /HJDO1DPHLIGLIIHUHQW3DFLILF6\PSKRQ\$VVRFLDWLRQ )HGHUDO7D[,'1R 0DLOLQJ$GGUHVV )LWFK6XLWH &LW\=LSFRGH ,59,1( &RQWDFW1DPH /XLVD&DULDJD 3KRQHQXPEHU )D[1XPEHU (PDLODGGUHVV OFDULDJD#SDFLILFV\PSKRQ\RUJ :HEVLWH ZZZ3DFLILF6\PSKRQ\RUJ *HRJUDSKLFDO$UHD6HUYHG 2UDQJH&RXQW\ +DYH\RXUHFHLYHGD&LW\RI1HZSRUW%HDFK &XOWXUDO$UWV*UDQWEHIRUH" <HV ,IVRZKDW\HDUGLG\RXUHFHLYHDJUDQW" <HDURUJDQL]DWLRQZDVIRXQGHG 1XPEHURISDLGVWDII 1XPEHURIDFWLYHYROXQWHHUV 7RWDODPRXQWUHTXHVWHGIURPUHTXHVWOLQHRI SURMHFWEXGJHW (VWLPDWHGQXPEHURISHRSOHLQ1HZSRUW%HDFK WKDWWKHSURSRVHGSURMHFWVZLOOVHUYH 1 of 14 ATTACHMENT F 134 %ULHIO\GHVFULEHEHORZ\RXURUJDQL]DWLRQ V SXUSRVHPLVVLRQDQGJRDOV 3DFLILF6\PSKRQ\ಬVPLVVLRQLVWRSHUIRUP LQVSLULQJHQWHUWDLQLQJDQGKHDOLQJPXVLF FRQQHFWFRPPXQLWLHVWKURXJKGLYHUVH SURJUDPPLQJLQVSLUH\RXWKSURYLGHWKHUDSHXWLF EHQHILWVDQGSURPRWHWKHZHOOEHLQJRIWKH SHRSOHZHVHUYHLQVRXWKHUQ&DOLIRUQLD7KH RUFKHVWUDZDVIRXQGHGLQWRSURYLGH PXVLFDOFRQFHUWVIRUWKHUHJLRQDQGUHPDLQVWKH ODUJHVW$PHULFDQPXVLFHQVHPEOHIRUPHGLQWKH ODVW\HDUV 3DFLILF6\PSKRQ\ಬVVWUDWHJLFRUJDQL]DWLRQDO JRDOVDUHWR%HDYLEUDQWDQGLQFOXVLYHFXOWXUDO DQFKRUUHFRJQL]HGIRUWKHSXEOLFYDOXHRILWV ZRUN&XOWLYDWHDUWLVWLFYLWDOLW\DQGJURZPDUNHW VKDUHWKURXJKWKHFRQWLQXRXVHYROXWLRQRILWV ZRUN)RVWHUZHOOQHVVVSDUNLQVSLUDWLRQ GHHSHQVHOIDZDUHQHVVDQGQXUWXUHD]HDOIRUOLIH WKURXJKGHHSHUSDUWLFLSDWLRQZLWKRUFKHVWUDO PXVLFLQRUGHUWROHYHUDJHSRVLWLYHHGXFDWLRQDO DQGFRPPXQLW\HQJDJHPHQWRXWFRPHVDQG %XLOGLQWHUQDOFXOWXUHDQGLQVWLWXWLRQDOFDSDFLW\ 7KH6\PSKRQ\SUHVHQWVPRUHWKDQ SHUIRUPDQFHVIRUWKHSXEOLFVHUYLQJ UHVLGHQWVDQGYLVLWRUVHDFK\HDU(GXFDWLRQDQG FRPPXQLW\HQJDJHPHQWSURJUDPVSURGXFHPRUH WKDQGLVWLQFWOHDUQLQJDQGDUWVSDUWLFLSDWLRQ RSSRUWXQLWLHVDQQXDOO\1RZIXOO\UHVWRUHG IROORZLQJWKHSDQGHPLFSURJUDPVDQGVHUYLFHV IXUQLVK.VWXGHQWVZLWKLQWHUDFWLYHPXVLF HQULFKPHQWWKURXJK&ODVV$FWWKHIRFXVRIWKLV UHTXHVWZKLOHVHUYLQJXQGHUUHSUHVHQWHGDQG YXOQHUDEOHSRSXODWLRQVWKURXJKWKH+HDUWVWULQJV LQLWLDWLYHDQGRWKHU VSHFLDOO\GHVLJQHGDQGWDLORUHGSURJUDPVIRU UHVLGHQWV ,GHQWLI\DQGGHVFULEHZK\WKHUHLVDQHHGLQ&ODVV$FWLVXQGXSOLFDWHGLQ2UDQJH&RXQW\DVLW 2 of 14 135 WWKH1HZSRUW%HDFK&RPPXQLW\IRU\RXU SURSRVHGSURMHFWSURJUDP,QFOXGHDTXDQWLWDWLYH GHVFULSWLRQRIWKHQHHGDQGRQZKDW\RXEDVHG \RXUILQGLQJVLHಯ%DVHGRQDVWXG\GRQHE\WKH 37$WKHUHDUHRQHKXQGUHGFKLOGUHQLQWKHWK WKJUDGHVDW1HZSRUW(OHPHQWDU\ZKRKDYHKDG QRWUDLQLQJZLWKPXVLFDOLQVWUXPHQWVರ'HVFULEH KRZ\RXKDYHGHWHUPLQHGWKDW\RXURUJDQL]DWLRQ LVWKHEHVWRUJDQL]DWLRQIRUWKHSURSRVHGSURMHFW SURJUDP SURYLGHVPXVLFHGXFDWLRQDQGDUWVRSSRUWXQLWLHV IRUVWXGHQWVWROHDUQGLUHFWO\IURPSURIHVVLRQDO 3DFLILF6\PSKRQ\PXVLFLDQV2UFKHVWUDSOD\HUV VHUYHDVWHDFKLQJDUWLVWVFRDFKHVDQGPHQWRUV LQVSLULQJVWXGHQWVWRDFKLHYHWKHLUDFDGHPLF JRDOVWKURXJKPXVLFHQULFKPHQW7KHSURJUDP DOVRKHOSVVFKRROFKLOGUHQLPSURYHNH\OLIHVNLOOV IURPWKHLUPXVLFDOVWXGLHVZKLFKLVSURYHQWR DGYDQFHVWXGHQWVFKRODVWLFSHUIRUPDQFH)RU H[DPSOHLQDQGWKH1DWLRQDO6FLHQFH )RXQGDWLRQUHVHDUFKHGFRQQHFWLRQVEHWZHHQ PXVLFDOLQVWUXFWLRQDQGDWWHQWLRQVSDQDQG GLVFRYHUHGWKDWPXVLFHGXFDWLRQLVDVVRFLDWHG ZLWKHQKDQFHGDELOLWLHVLQPDWKFUHDWLYLW\ UHDGLQJFRJQLWLRQFULWLFDOWKLQNLQJDQG FRPPXQLFDWLRQVNLOOV0XVLFKDVDOVREHHQ VKRZQWRLPSURYHPRWLYDWLRQFRQFHQWUDWLRQ FRQILGHQFHSRLVHDQGWHDPZRUN 0RUHUHFHQWO\LQ'HFHPEHUUHVHDUFK VWXGLHVDWWKH1HXURDUWV5HVRXUFH&HQWHUDW -RKQV+RSNLQV8QLYHUVLW\VKRZWKDWZKHQZH DWWHQGDQDUWVHYHQWRUFUHDWHDUWRXUVHOYHV PHDVXUDEOHWUDQVIRUPDWLRQVWDNHSODFHVWUHVV DQGDQ[LHW\GHFUHDVHVOLIHVDWLVIDFWLRQDQG PHQWDOKHDOWKLPSURYHVDQGFRJQLWLYHGHFOLQHLV VORZHG5HPDUNDEO\MXVWPLQXWHVRI DUWPDNLQJORZHUVWKHVWUHVVKRUPRQHFRUWLVROE\ )RUWKLVSURMHFW&ODVV$FWHQKDQFHVDUWV OHDUQLQJIRUVWXGHQWVKHOSLQJPXVLFSURJUDPV DXJPHQWDFWLYLWLHVLQ1HZSRUW%HDFKDQGRWKHU ORFDOVFKRROV&ODVV$FWLVWKHRQO\DUWVHGXFDWLRQ SURJUDPLQ2UDQJH&RXQW\ZKLFKRIIHUVWKH H[SHUWLVHRI6\PSKRQ\DIILOLDWHGSURIHVVLRQDO PXVLFLDQV 'HVFULEHWKHVSHFLILFSURMHFWSURJUDPWKDWZLOO EHIXQGHGE\DFXOWXUDOJUDQW,QFOXGHKRZWKH SURSRVHGSURMHFWSURJUDPZLOOEHLPSOHPHQWHG *UDQWIXQGVDUHUHTXHVWHGIRUWKH&ODVV$FW 0XVLF(GXFDWLRQ3URJUDPLQRQH1HZSRUW%HDFK VFKRROWKLV\HDU1HZSRUW&RDVW(OHPHQWDU\ 3 of 14 136 DDQGRXWOLQHDVFKHGXOHRUSURMHFWWLPHOLQHZLWK SODQQHGGDWHVDQGORFDWLRQV,GHQWLI\LQGLYLGXDOV DQGJURXSVLQYROYHGSDUWLFXODUO\DUWLVWVDQG SHUIRUPHUVDQGGHVFULEHWKHLUUROHVDQG UHVSRQVLELOLWLHV'HVFULEHWKHEDFNJURXQGDQG TXDOLILFDWLRQVRI\RXURUJDQL]DWLRQDQGNH\ SHUVRQQHOWREHLQYROYHGLQWKHSURJUDP 5HPHPEHUWKH&LW\IXQGVRQO\SURMHFWVDQG SURJUDPVQRWRSHUDWLQJH[SHQVHV7KHVH SURMHFWVDQGSURJUDPVPXVWSURPRWHFRPPXQLW\ LQYROYHPHQWDQGDZDUHQHVVRIWKHDUWVLQ 1HZSRUW%HDFK 6FKRRO&ODVV$FWKDVPHWWKHFRPPXQLW\ಬVQHHG IRUSURIHVVLRQDOPXVLFHGXFDWLRQIRU\HDUV KHOSLQJ2UDQJH&RXQW\VFKRROVVWUHQJWKHQ VWXGHQWDFDGHPLFDFKLHYHPHQW7KHSURJUDP WUDLQVDQGDVVLJQV3DFLILF6\PSKRQ\XQLRQ PXVLFLDQVLQWRVFKRROVZKHUHVWXGHQWVUHFHLYH PHDQLQJIXOPXVLFOHDUQLQJIURPWHDFKLQJDUWLVWV LQWKHFODVVURRP7KURXJK\HDUORQJUHVLGHQFLHV LQHDFKVFKRROPXVLFLDQVIRFXVRQWKH IXQGDPHQWDOVRIPXVLFWKURXJKDJHDSSURSULDWH FODVVURRPLQVWUXFWLRQRQVLWHVFKRRO SHUIRUPDQFHVDQGDWULSWRWKHFRQFHUWKDOOIRUD IXOO3DFLILF6\PSKRQ\SHUIRUPDQFH &ODVV$FWUXQVIURP6HSWHPEHUWR-XQHHDFK \HDUZLWKVWXGHQWSDUWLFLSDWLRQEHJLQQLQJLQ 1RYHPEHU7KHSURJUDPVWDIIGHVLJQV&RPPRQ &RUHFXUULFXOXPEDVHGZRUNVKRSPDWHULDOVDQG OHVVRQSODQVXVLQJDWKHPHDQGFRPSRVHUHDFK \HDUಯ$PHULFDWKH%HDXWLIXOರZLWK$DURQ&RSODQG LQ0DWHULDOVDUHGHOLYHUHGWRFODVVURRP WHDFKHUVGXULQJSURIHVVLRQDOGHYHORSPHQWDQG WUDLQLQJZRUNVKRSVZKHUHWKH\OHDUQWRLQWHJUDWH PXVLFLQWRDOODUHDVRIOHDUQLQJ,QSHUVRQVWXGHQW DFWLYLWLHVDQGZRUNVKRSVUXQWKURXJKRXWWKH DFDGHPLF\HDUDQG<RXWK&RQFHUWVDUH SUHVHQWHGLQ0D\$VVHVVPHQWVDQGHYDOXDWLRQV DUHFRQGXFWHGGXULQJDQGDIWHUDOOVWXGHQW DFWLYLWLHV6WDIIPHDVXUHVSURJUDPHIIHFWLYHQHVV WKURXJKRXWWKH\HDUWRPRQLWRUVWXGHQWSURJUHVV DQGWRHQVXUHRXWFRPHVDQGJRDOVDUHPHW &ODVV$FWHQJDJHVWKHHQWLUHVWXGHQWERG\DW 1HZSRUW&RDVWDVZHOODVWHDFKHUVDQGSULQFLSDOV SDUHQWVDGPLQLVWUDWRUVDQGYROXQWHHUVDOVR SDUWLFLSDWH7KHUHDUHILYHPXVLFLDQVZKRVHUYH ILIWHHQVFKRROVLQWKHIXOO&ODVV$FW SURJUDPDFURVVWKH 4 of 14 137 FRXQW\ZLWKVFKRROVDVVLJQHGDGLIIHUHQW PXVLFLDQHDFK\HDU7KHSURJUDPLVOHGE\ 'LUHFWRURI(GXFDWLRQ/HLJKDQQD6HDUVZKR MRLQHGWKHVWDIILQDQGOHDGVDWHDPRI VHYHQZKRPDQDJHDQGRYHUVHHDOOSURJUDP FRPSRQHQWVVFKHGXOLQJDQGDFWLYLWLHV6LQFHLWV LQFHSWLRQ&ODVV$FWKDVVHUYHGPRUHWKDQ VWXGHQWVWHDFKHUVDQGSULQFLSDOVLQ 2UDQJH&RXQW\RYHUD\HDUKLVWRU\ ,,VWKLVDQHZRUH[LVWLQJSURMHFWSURJUDP"([LVWLQJSURJUDP 'HILQHRUGHVFULEHWKHVHJPHQWRIWKH SRSXODWLRQLQ1HZSRUW%HDFKWKDW\RXLQWHQGWR VHUYHE\\RXUSURMHFWSURJUDP,QFOXGHVXFK WKLQJVDVDJHORFDWLRQQXPEHUVVHUYHGHWF ,Q&ODVV$FWZLOOVHUYHFKLOGUHQLQ 1HZSRUW&RDVW(OHPHQWDU\6FKRROWRJHWKHUZLWK WHDFKHUVDQGSULQFLSDOIRUDWRWDORI EHQHILFLDULHV1HZSRUW&RDVWVHUYHV .LQGHUJDUWHQWRWKJUDGHVWXGHQWVDJHV 7KHVFKRROKDVSDUWQHUHGZLWK&ODVV$FWIRU VHYHQWHHQQRQFRQVHFXWLYH\HDUVDQGKDVVHHQ JUHDWSURJUHVVLQWKHLUVWXGHQWVZLWKWKH DVVLVWDQFHRIJUDQWVXSSRUWIURPWKH1HZSRUW %HDFK&LW\$UWV&RPPLVVLRQ 352-(&7%8'*(7([SHQVHV3HUVRQQHO $UWLVWLF )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV $GPLQLVWUDWLYH )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 7HFKQLFDO3URGXFWLRQ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 352-(&7%8'*(7([SHQVHV2SHUDWLQJ )DFLOLW\([SHQVH6SDFH5HQWDO 5 of 14 138 ))XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 0DUNHWLQJ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 3URGXFWLRQ([KLELWLRQ([SHQVH )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 7RXULQJ3UHVHQWDWLRQ([SHQVH )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV (GXFDWLRQ0DWHULDOV )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 7UDQVSRUWDWLRQ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV (TXLSPHQW )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 2WKHULIJUHDWHUWKDQDQQRWDWHEHORZ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV *5$1'727$/ 'HVFULEHWKHH[SHFWHGTXDQWLILDEOHRXWFRPHV RI\RXUSURMHFWSURJUDPDQGKRZ\RXZLOO HYDOXDWHWKHUHVXOWV%HYHU\VSHFLILFLQ DGGUHVVLQJWKHZD\VWKDW\RXZLOOGHWHUPLQHWKDW 7KHRYHUDOOGHVLUHGRXWFRPHLVIRU. HOHPHQWDU\VFKRROFKLOGUHQWRLPSURYHWKHLU DFDGHPLFDFKLHYHPHQWWKURXJKWKH&ODVV$FW PXVLFHGXFDWLRQSURJUDP7KHRYHUDUFKLQJ 6 of 14 139 \\RXUSURMHFWSURJUDPPHWWKHQHHGVWKDW\RX LGHQWLILHGDQGDFFRPSOLVKHVWKHJRDOV\RXVHWRXW WRDFKLHYHLH\RXSURYLGHKRXUVRIPXVLFDO LQVWUXFWLRQDQGLQVWUXPHQWVWRWKHFKLOGUHQDW 1HZSRUW(OHPHQWDU\VFKRRODVPHDVXUHGE\ PXVLFVWRUHUHQWDOUHFHLSWVDQGORJVRI LQVWUXFWRUV RXWFRPHIRUHGXFDWRUVLVWRLPSURYHWKHLUPXVLF DSWLWXGHLQRUGHUWRWHDFKWKHDUWVPRUH HIIHFWLYHO\DQGDXJPHQWVWXGHQWOHDUQLQJLQ PXVLF7KHTXDQWLILDEOHRXWFRPHVIRU 1HZSRUW%HDFKVWXGHQWVDQGWHDFKHUVDUH D$WRWDORIRURIWKHHVWLPDWHG VWXGHQWVZLOOGHPRQVWUDWHLQFUHDVHGNQRZOHGJH DERXWWKH&ODVV$FWFRPSRVHURIWKH\HDU$DURQ &RSODQGDQGWKHLUPXVLF2XWFRPHVDUH PHDVXUHGWKURXJKSUHDQGSRVWSURJUDPWHVWLQJ TXHVWLRQQDLUHVDQGWHDFKHUVXUYH\V E$WRWDORIVWXGHQWVRXWRIZLOOH[SUHVVD GHVLUHWRFRQWLQXHWRHQJDJHLQPXVLFDQGWKH DUWVUHSUHVHQWLQJRIDOO&ODVV$FWVWXGHQWV 5HVXOWVDUHTXDQWLILHGWKURXJKSUHDQGSRVW SURJUDPVXUYH\VDORQJZLWKSDUHQWWHDFKHU FRPPHQWVDQGIHHGEDFNDQGVWXGHQWHQUROOPHQW LQVXEVHTXHQWPXVLFDQGDUWVSURJUDPV F$WRWDORIRURIWKH&ODVV$FW WHDFKHUVZLOOLQFUHDVHWKHLUFDSDFLW\WRWHDFKWKH DUWVPRUHHIIHFWLYHO\LQWKHFODVVURRPDQGEHWWHU VXSSRUWWKH&RPPRQ&RUH7KHUHVXOWVDUH PHDVXUHGIURPWHDFKHUDQGSULQFLSDOVXUYH\V LQGLYLGXDOLQWHUYLHZVRQHRQRQHIROORZXSDQG LQSHUVRQPHHWLQJVZLWKWHDFKHUV /LVWRI%RDUG0HPEHUVDQGWKHLUDIILOLDWLRQV 5HFHQWOLVWRILQGLYLGXDOVFRUSRUDWLRQVDQG IRXQGDWLRQVWKDWSURYLGHRUJDQL]DWLRQDOVXSSRUW ,56'HWHUPLQDWLRQ/HWWHULI\RXDUHD FbLQGLFDWLQJWD[H[HPSWVWDWXV 2QHEURFKXUHDQGRURQHSUHVVFOLSSLQJ , ,QFRPHFDVKRQO\ 7 of 14 Document found on page 10. Document found on page 11. Document found on pages 12-13. Document found on page 14. 140 &&RQWULEXWHG )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG (DUQHG )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 7RWDO,QFRPH )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG ,, ([SHQVHV 3URJUDP )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG *HQHUDODQG$GPLQLVWUDWLYH )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 0DUNHWLQJDQG'HYHORSPHQW )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 7RWDO([SHQVHV )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG ,WHP ,,, 2SHUDWLQJ6XUSOXV'HILFLW,QFRPHPLQXV([SHQVHV )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG ,9 )XQG%DODQFHDW%HJLQQLQJRI<HDU 8 of 14 141 ))<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG 9 $FFXPXODWHGG6XUSOXVV'HILFLW$GGGOLQHVV,,,,DQGG,9 )<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG ,WHPP 9, ,Q.LQGG&RQWULEXWLRQVVDWWDFKKVFKHGXOHVVLIIJUHDWHUUWKDQQRIIWRWDOOLQFRPH )<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG ,,YHULI\\WKHHNQRZOHGJHHWKDWWWKHHLQIRUPDWLRQQ VXEPLWWHGGLQQWKLVVDSSOLFDWLRQQLVVWUXHHDQGGFRUUHFWWWRR WKHHEHVWWRIIP\\NQRZOHGJH 1DPH /XLVD&DULDJD 7LWOH 'LUHFWRURI,QVWLWXWLRQDO*LYLQJ /DVWW8SGDWH 6WDUWW7LPH )LQLVKK7LPH 3RZHUHGE\)RUPVLWH9 of 14 142 Board of Directors 2024-25 Michael Adams, Business Leader *Susan Anderson, Co-Vice Chair Development *Leona Aronoff-Sadacca, Retired *Jo Ellen Chatham, Retired Patrick Chen, JETCC Investments Alayne Cortes, NC Private Bank Robert F. Davey, Retired William Dolan, U.S. Bank Lucy Dunn, Orange County Business Council Cynthia Ellis, Musician Representative *John R. Evans, Immediate Past Chair Mohsen Fahmi, Retired *John E. Forsyte, President and CEO *Barbara Foster, Insights Worldwide Maria Francis, Community Leader *Michael S. Gordon, First Q Capital Nick Guanzon-Greenko, Tangram Interiors Andy Hanson, Meyerhoff Hanson Crance Janine Heft, City of Laguna Hills Brian Hervey, UCI Foundation Arnold Holland, CSU Fullerton Michelle M. Horowitz, Community Leader James Newton Howard, JNH Studios Donald Hu, JDH Pacific Reza Jahangiri, American Advisors Group Patrick Johnson, Biphotas *Seth R. Johnson, Community Leader Edward Kim, City of Hope Johanna Kim, Kerymen LLC *Joann Leatherby, Leatherby Foundation Agnes Lew, East West Bank Robin Liu, Cabinetry 1 Inc. *Phillip N. Lyons, Pinecreek Investment Co. *Diana Martin, Co-Vice Chair Development *Patricia McAuley, Community Leader David V. Melilli, David Melilli Company Haydee Mollura, Community Leader Elliott Moreau, Musician Representative Maurice Murray, J.P.Morgan Private Bank Tawni Nguyen, Merrill Lynch Wealth Mgmt *Mark Nielsen, Executive Vice Chair *Arthur Ong, Chair *Anoosheh Oskourian, Ship & Shore Environ Karin Pearson, Capital Group *Judith Posnikoff, Martlet Asset Mgmt LLC Michelle Rohé, Community Leader *Chiyo Rowe, Community Leader Yassmin Sarmadi, Knife Pleat Robert Schumitzky, Musician Rep. Scott Seigel, California Closets Evan B. Siegel, Ground Zero Pharma. Hon. Warren H. Siegel, Retired Ron Simon, RSI Holding Corporation Walter Stahr, Author Andrea Steiner, Retired *Andria Strelow. Board Secretary *M.C. Sungaila, Complex Appellate Lit. Group *CarolAnn Tassios, Community Leader Andy Thorburn, Community Leader *Christopher Tower, Board Treasurer *Bart Van Aardenne, Terranet Framroze Virjee, AGB W. Henry Walker, Farmers & Merchants Bank *Judy Whitmore, Community Leader Nancy Wong, Real Estate Investor Jane Fujishige Yada, Fujishige Farms, Inc. Officers in Bold *Executive Committee Rev. 11/5/2025 10 of 14 143 Pacific Symphony Institutional Support 2024-25 ($5000 and up) for fiscal year ending June 30, 2025 Foundations and Corporations 2024-25 Hal and Jeanette Segerstrom Family Foundation $ 1,000,000 Schwab Charitable Fund 586,100$ Lyons Share Foundation 572,956$ William and Nancy Thompson Foundation 460,200$ Zion Charity Foundation 410,000$ Ahmanson Charitable Community Trust 370,000$ Samueli Foundation 350,000$ Fidelilty Charitable Gift Fund $ 260,410 Jewish Community Foundation of Orange County $ 252,202 Joe MacPherson Foundation $ 250,000 Orange County Community Foundation 229,654$ Bank of America/BofA Foundation/Charitable Gift Fund $ 212,500 Farmers and Merchants Bank 154,000$ The Nicholas Endowment 154,000$ Hanson Family Foundation 140,000$ California Community Foundation $ 137,500 Simon Foundation for Education 125,000$ Morgan Stanley $ 115,000 City of Hope $ 106,000 PNC Bank 102,000$ The Segerstrom Foundation $ 100,000 Lugano Diamonds $85,000 East West Bank $80,000 Tiffany & Co. $75,000 National Christian Foundation California $70,000 Wells Fargo Advisors $67,500 Isidore and Penny Myers Foundation $64,903 Loftus Family Foundation $60,000 South Coast Plaza $60,000 U.S. Bank/U.S. Bancorp Foundation $60,000 UBS Financial Services $56,000 Starland Enterprises $55,000 The Colburn Foundation $55,000 Horowitz Management, Inc. $51,000 US Charitable Gift Trust $50,000 Chapman University $50,000 SchoolsFirst Federal Credit Union 45,000$ The Capital Group Companies 50,000$ Hoag Memorial Hospital $49,000 The UCI Foundation $45,000 Mark Chapin Johnson Foundation $45,000 Bluebird Legacy, Inc. $40,000 Van Cleef & Arpels $40,000 Argyros Family Foundation 35,000$ Fidelity Brokerage Services LLC $32,000 UHL and KK Foundation $31,000 LPL Financial $30,500 Leatherby Family Foundation $30,000 National Philanthropic Trust $30,000 Raymond James Global $30,000 Wilfred and Janet Roof Foundation $25,000 Huang Family Foundation $25,000 Troob Family Foundation 25,000$ Green Foundation $25,000 Kennedy Foundation $29,500 East Sunrise Investments LLC $20,000 Farhang Foundation $20,000 Ship & Shore Environmental, Inc. $20,000 Margolis Family Foundation $18,000 California State University Fullerton $15,000 Pacific Life Foundation $15,000 Troy Group, Inc.15,000$ SPA Music & Education Foundation $13,000 Northern Trust $10,000 AYCO Charitable Foundation $10,000 Bialer Family Foundation $10,000 Langson Family Foundation $10,000 Fletcher Jones Foundation $10,000 Nellie Leaman Taft Foundation $10,000 Pledgeling Foundation $10,000 Shanbron Family Foundation $10,000 Crean Foundation $10,000 Labowe Family Foundation $10,000 RDJH Enterprises LLC $5,000 E. Nakamichi Foundation $5,000 The Gerrit and Amy Cole Foundation $5,000 O.L. Halsell Foundation $5,000 Greater Houston Community Foundation $5,000 Sample Foundation and Corporate Support 7,949,925$ 11 of 14 144 12 of 14 145 13 of 14 146 Pacific Symphony’s flagship educational program, Class Act, brings the joy of music to up to 40 schools across Orange County every year! BringaP a c i f i c S y m p h o n y musician t o y o u r s c h o o l ! AttendaPacific S y m p h o n y performancewi t h y o u r s t u d e n t s atSegerstromC o n c e r t H a l l Enjoyaperform a n c e b y P a c i f i c Symphony m u s i c i a n s a t y o u r schoolduringFa m i l y N i g h t ! Participation in the Class Act program brings a Pacific Symphony musician to your school as a partner in music education. Enjoy lessons, performances, and curriculum all aligned with state and national standards, as well as an increase in the connections with your school community. Space is limited, so reserve your spot today! Email Class Act classact@pacificsymphony.org for more information!14 of 14 147 &&XOWXUDO$UWV*UDQWV$SSOLFDWLRQ)RUP 5HIHUHQFH 6WDWXV &RPSOHWH /RJLQ8VHUQDPH JUDQWV#VFURUJ /RJLQ(PDLO JUDQWV#VFURUJ 3RSXODU1DPHRI2UJDQL]DWLRQ 6RXWK&RDVW5HSHUWRU\ /HJDO1DPHLIGLIIHUHQW6RXWK&RDVW5HSHUWRU\,QF )HGHUDO7D[,'1R 0DLOLQJ$GGUHVV 7RZQ&HQWHU'ULYH &LW\=LSFRGH &RVWD0HVD &RQWDFW1DPH &ODUH.LNORZLF] 3KRQHQXPEHU (PDLODGGUHVV FODUH#VFURUJ :HEVLWH ZZZVFURUJ *HRJUDSKLFDO$UHD6HUYHG 2UDQJH&RXQW\&$ +DYH\RXUHFHLYHGD&LW\RI1HZSRUW%HDFK &XOWXUDO$UWV*UDQWEHIRUH" <HV ,IVRZKDW\HDUGLG\RXUHFHLYHDJUDQW" <HDURUJDQL]DWLRQZDVIRXQGHG 1XPEHURISDLGVWDII 1XPEHURIDFWLYHYROXQWHHUV 7RWDODPRXQWUHTXHVWHGIURPUHTXHVWOLQHRI SURMHFWEXGJHW (VWLPDWHGQXPEHURISHRSOHLQ1HZSRUW%HDFK WKDWWKHSURSRVHGSURMHFWVZLOOVHUYH :HHVWLPDWHWKDWDSSUR[LPDWHO\UHVLGHQWV RI1HZSRUW%HDFKZLOODWWHQGSHUIRUPDQFHVVHH UHVSRQVHWRTXHVWLRQ %ULHIO\GHVFULEHEHORZ\RXURUJDQL]DWLRQ V6RXWK&RDVW5HSHUWRU\ZDVIRXQGHGLQWKHEHOLHI 1 of 25 ATTACHMENT G 148 SSXUSRVHPLVVLRQDQGJRDOVWKDWWKHDWUHLVDQDUWIRUPZLWKDXQLTXHSRZHUWR LOOXPLQDWHWKHKXPDQH[SHULHQFH:HFRPPLW RXUVHOYHVWRH[SORULQJXUJHQWKXPDQDQGVRFLDO LVVXHVRIRXUWLPHDQGWRPHUJLQJOLWHUDWXUH GHVLJQDQGSHUIRUPDQFHLQZD\VWKDWWHVWWKH ERXQGVRIWKHDWUH VDUWLVWLFSRVVLELOLWLHV:H XQGHUWDNHWRDGYDQFHWKHDUWRIWKHDWUHLQWKH VHUYLFHRIRXUFRPPXQLW\DQGDLPWRH[WHQGWKDW VHUYLFHWKURXJKHGXFDWLRQDOLQWHUFXOWXUDODQG FRPPXQLW\HQJDJHPHQWSURJUDPVWKDW KDUPRQL]HZLWKRXUDUWLVWLFPLVVLRQ 7KLVPLVVLRQGLUHFWO\LQIRUPVRXURSHUDWLRQV SURJUDPPLQJDQGRUJDQL]DWLRQDOFXOWXUH,W JXLGHVKRZZHFKRRVHRXUVHDVRQVZKLFK DUWLVWVZHVXSSRUWKRZZHFROODERUDWHZLWKRXU DXGLHQFHVDQGKRZZHVHUYHWKHEURDGHU FRPPXQLW\,WLVUHIOHFWHGLQRXUFRPPLWPHQWWR GHYHORSLQJDQGSURGXFLQJQHZZRUN FRPPLVVLRQVDQGZRUOGSUHPLHUHVWRGDWH DQGLQRXUUROHDVDQDWLRQDOOHDGHULQQHZSOD\ GHYHORSPHQWWKURXJK7KH/DE#6&5DQGWKH 3DFLILF3OD\ZULJKWV)HVWLYDO /RFDOO\ZHVHUYHDVDFXOWXUDODQFKRULQ2UDQJH &RXQW\RIIHULQJ\HDUURXQGRSSRUWXQLWLHVIRU FRQQHFWLRQDQGFUHDWLYHH[SUHVVLRQ2XU7KHDWUH IRU<RXQJ$XGLHQFHVSURGXFWLRQVIUHHDQG VXEVLGL]HGWLFNHWSURJUDPVDFWLQJFODVVHVDQG VFKRROEDVHGUHVLGHQFLHVUHDFKWKRXVDQGVRI VWXGHQWVDQGFRPPXQLW\PHPEHUVDQQXDOO\ PDQ\IURPXQGHUVHUYHGSRSXODWLRQV7KHVH SURJUDPVDUHQRWDGGRQVEXWFHQWUDOWRRXU LGHQWLW\DVDWKHDWUHFRPPLWWHGWRDUWLVWLF LQQRYDWLRQDFFHVVLELOLW\DQGPHDQLQJIXOSXEOLF VHUYLFH ,GHQWLI\DQGGHVFULEHZK\WKHUHLVDQHHGLQ WKH1HZSRUW%HDFK&RPPXQLW\IRU\RXU 6LQFHLWVIRXQGLQJLQ6RXWK&RDVW 5HSHUWRU\KDVEHHQDYLWDOFXOWXUDOLQVWLWXWLRQ 2 of 25 149 VHUYLQJ2UDQJH&RXQW\LQFOXGLQJWKH1HZSRUW %HDFKFRPPXQLW\'HVSLWHWKHDUHDಬVRYHUDOO DIIOXHQFHWKHUHUHPDLQVDFOHDUQHHGIRU DFFHVVLEOHDUWVHGXFDWLRQDQGOLYHWKHDWUH H[SHULHQFHVIRUFKLOGUHQDQGIDPLOLHVSDUWLFXODUO\ WKRVHIURPXQGHUVHUYHGEDFNJURXQGV 7KH1HZSRUW0HVD8QLILHG6FKRRO'LVWULFW 1086'ZKLFKVHUYHV1HZSRUW%HDFK HGXFDWHVDSSUR[LPDWHO\VWXGHQWVZLWK DSSUR[LPDWHO\TXDOLI\LQJIRUIUHHRUUHGXFHG SULFHOXQFK7KHVHILJXUHVGHPRQVWUDWHWKDWD VXEVWDQWLDOQXPEHURIVWXGHQWVIDFHHFRQRPLF EDUULHUVWKDWFDQOLPLWDFFHVVWRDUWVHQULFKPHQW RSSRUWXQLWLHV$WWKHVDPHWLPHRQJRLQJ XQGHUIXQGLQJRIDUWVHGXFDWLRQDWWKHORFDODQG QDWLRQDOOHYHOVKDVOHIWPDQ\VFKRROVZLWKRXWWKH UHVRXUFHVWRRIIHUFRQVLVWHQWKLJKTXDOLW\ SHUIRUPLQJDUWVH[SHULHQFHV 6&5ಬV(GXFDWLRQDQG$FFHVVLQLWLDWLYHVLQFOXGH 7KHDWUHIRU<RXQJ$XGLHQFHV7<$7KHDWUH $FFHVVDQG0\6WDJH7KHVHSURJUDPVDUH GHVLJQHGWRDGGUHVVWKLVQHHGE\SURYLGLQJIUHH DQGORZFRVWSHUIRUPDQFHVWUDQVSRUWDWLRQ DVVLVWDQFHDQGFXUULFXOXPDOLJQHGHGXFDWLRQDO PDWHULDOV,QUHFHQWVHDVRQV7<$KDVVHUYHG WKRXVDQGVRIHOHPHQWDU\VFKRROVWXGHQWV LQFOXGLQJVLJQLILFDQWSDUWLFLSDWLRQIURP1086' VFKRROV$GGLWLRQDOO\WKURXJK7KHDWUH$FFHVV DQG0\6WDJH6&5SURYLGHVPRUHWKDQ IUHHWLFNHWVDQQXDOO\WRRXUPDLQVWDJH SURGXFWLRQVWRORFDOVFKRROVDQGFRPPXQLW\ RUJDQL]DWLRQVLQFOXGLQJWKRVHVHUYLQJ1HZSRUW %HDFKUHVLGHQWV :LWKPRUHWKDQVL[GHFDGHVRIH[SHULHQFH GHOLYHULQJSURIHVVLRQDOWKHDWUHDQGDUWV SSURSRVHGSURMHFWSURJUDP,QFOXGHDTXDQWLWDWLYH GHVFULSWLRQRIWKHQHHGDQGRQZKDW\RXEDVHG \RXUILQGLQJVLHಯ%DVHGRQDVWXG\GRQHE\WKH 37$WKHUHDUHRQHKXQGUHGFKLOGUHQLQWKHWK WKJUDGHVDW1HZSRUW(OHPHQWDU\ZKRKDYHKDG QRWUDLQLQJZLWKPXVLFDOLQVWUXPHQWVರ'HVFULEH KRZ\RXKDYHGHWHUPLQHGWKDW\RXURUJDQL]DWLRQ LVWKHEHVWRUJDQL]DWLRQIRUWKHSURSRVHGSURMHFW SURJUDP 3 of 25 150 HGXFDWLRQ6&5LVXQLTXHO\SRVLWLRQHGWRPHHW WKHQHHGVRIWKH1HZSRUW%HDFKFRPPXQLW\,WV ORQJVWDQGLQJ SDUWQHUVKLSVZLWKORFDOVFKRROVDQG FRPPLWPHQWWRHTXLWDEOHDFFHVVHQVXUHWKDW FKLOGUHQDQGIDPLOLHVFDQHQJDJHZLWKKLJK TXDOLW\FXOWXUDOSURJUDPPLQJWKDWIRVWHUV FUHDWLYLW\FROODERUDWLRQDQGOLIHORQJDSSUHFLDWLRQ IRUWKHDUWV 6RXWK&RDVW5HSHUWRU\ಬV7KHDWUHIRU<RXQJ $XGLHQFHV7<$SURJUDPKDVEHHQD FRUQHUVWRQHRI6&5ಬVHGXFDWLRQDORXWUHDFKVLQFH SURYLGLQJSURIHVVLRQDOKLJKTXDOLW\WKHDWUH H[SHULHQFHVVSHFLILFDOO\GHVLJQHGIRU\RXQJ DXGLHQFHV7KHSURJUDPಬVPLVVLRQLVWRLQWURGXFH FKLOGUHQWRWKHWUDQVIRUPDWLYHSRZHURIOLYH WKHDWUHZKLOHIRVWHULQJFUHDWLYLW\LPDJLQDWLRQ DQGDOLIHORQJDSSUHFLDWLRQIRUWKHDUWV )RUWKHVHDVRQ6&5UHTXHVWVD &XOWXUDO$UWV*UDQWWRVXSSRUW&LQGHUHOOD$6DOVD )DLU\7DOHDELOLQJXDOIDPLO\IULHQGO\PXVLFDO ZULWWHQE\.DUHQ=DFDU¯DVZLWKPXVLFE\'HERUDK :LFNV/D3XPDDQGGLUHFWHGE\6DUD*XHUUHUR 7KLVOLYHO\SURGXFWLRQUHLPDJLQHVWKHFODVVLF &LQGHUHOODVWRU\LQDFRQWHPSRUDU\FXOWXUDOO\ULFK FRQWH[WEOHQGLQJVDOVDDQGKLSKRSPXVLFZLWK WKHPHVRIWHDPZRUNVSRUWVPDQVKLSDQG UHVSHFW6ZHHW&HQLFLHQWDVSHDNV6SDQLVKZKLOH 5RVDDVWDUEDVNHWEDOOSOD\HUVSHDNV(QJOLVK FUHDWLQJDSOD\IXOELOLQJXDOG\QDPLFWKDWWHDFKHV FXOWXUDODZDUHQHVVDQGOLQJXLVWLFDSSUHFLDWLRQ 7KHSURGXFWLRQLVVWDJHGRQ6&5ಬV-XOLDQQH $UJ\URV6WDJHDVSDUWRIWKH7KHDWUHIRU<RXQJ $XGLHQFHV )DPLOLHVSURJUDP 7KHVHDVRQLQFOXGHVSHUIRUPDQFHVIURP 'HVFULEHWKHVSHFLILFSURMHFWSURJUDPWKDWZLOO EHIXQGHGE\DFXOWXUDOJUDQW,QFOXGHKRZWKH SURSRVHGSURMHFWSURJUDPZLOOEHLPSOHPHQWHG DQGRXWOLQHDVFKHGXOHRUSURMHFWWLPHOLQHZLWK SODQQHGGDWHVDQGORFDWLRQV,GHQWLI\LQGLYLGXDOV DQGJURXSVLQYROYHGSDUWLFXODUO\DUWLVWVDQG SHUIRUPHUVDQGGHVFULEHWKHLUUROHVDQG UHVSRQVLELOLWLHV'HVFULEHWKHEDFNJURXQGDQG TXDOLILFDWLRQVRI\RXURUJDQL]DWLRQDQGNH\ SHUVRQQHOWREHLQYROYHGLQWKHSURJUDP 5HPHPEHUWKH&LW\IXQGVRQO\SURMHFWVDQG SURJUDPVQRWRSHUDWLQJH[SHQVHV7KHVH SURMHFWVDQGSURJUDPVPXVWSURPRWHFRPPXQLW\ LQYROYHPHQWDQGDZDUHQHVVRIWKHDUWVLQ 1HZSRUW%HDFK 4 of 25 151 )HEUXDU\WKURXJK0DUFKLQFOXGLQJ IUHHVFKRROGD\PDWLQHHVIRUORFDOVWXGHQWV SDUWLFXODUO\IURP7LWOHVFKRROVZLWKLQ1HZSRUW %HDFK7RHQVXUHHTXLWDEOHDFFHVV6&5ZLOO SURYLGHEXVWUDQVSRUWDWLRQVXEVLGLHVIRUVFKRROV WKDWUHTXLUHILQDQFLDOVXSSRUW3DLGSXEOLF SHUIRUPDQFHVZLOOEHDYDLODEOHWRIDPLOLHVDQGWKH EURDGHUFRPPXQLW\HQVXULQJZLGHDFFHVVLELOLW\ DQGHQJDJHPHQW (DFK7<$SURGXFWLRQPDLQWDLQVWKHVDPH SURIHVVLRQDOVWDQGDUGVDV 6&5ಬVDGXOWSURJUDPPLQJIHDWXULQJKLJK FDOLEHUDFWRUVGLUHFWRUVGHVLJQHUVDQG SURGXFWLRQWHDPV(GXFDWLRQDOPDWHULDOV LQFOXGLQJSURJUDPERRNOHWVDQGVWXG\JXLGHV DFFRPSDQ\HDFKSHUIRUPDQFHRIIHULQJWHDFKHUV WKHWRROVWRLQWHJUDWHWKHSOD\ಬVWKHPHVLQWR FODVVURRPOHDUQLQJDQGUHLQIRUFLQJLWVVRFLDO HPRWLRQDODQGFXOWXUDOOHVVRQV 7RDGGUHVVWKHHYROYLQJQHHGVRIWKHFRPPXQLW\ 6&5ZLOOSURYLGHRQHVHQVRU\IULHQGO\UHOD[HG SHUIRUPDQFH7KLVSHUIRUPDQFHLVGHVLJQHGEXW QRWOLPLWHGWRDXGLHQFHPHPEHUVRQWKHDXWLVP VSHFWUXPWKRVHZLWKVHQVRU\VHQVLWLYHVRU OHDUQLQJGLVDELOLWLHVDQGWKHLUIDPLOLHV6&5 SDUWQHUHGZLWK7KH$XWLVP&RPPXQLW\LQ$FWLRQ 7$&$WRDGGUHVVVSHFLILFFKDQJHVWR SURGXFWLRQHOHPHQWVDQGOREE\FRQILJXUDWLRQV %\SURYLGLQJIUHHWLFNHWVWUDQVSRUWDWLRQDQG KLJKTXDOLW\HGXFDWLRQDOUHVRXUFHV6&5HQVXUHV WKDW&LQGHUHOOD$6DOVD)DLU\7DOHUHDFKHV VWXGHQWVZKRPD\QRWRWKHUZLVHKDYHWKH RSSRUWXQLW\WRH[SHULHQFHOLYHWKHDWUH7KLV SURJUDPFXOWLYDWHVFUHDWLYLW\FXOWXUDOOLWHUDF\DQG FULWLFDOWKLQNLQJSRVLWLRQLQJ6&5DVDOHDGHULQ 5 of 25 152 DUWVHGXFDWLRQIRU\RXQJDXGLHQFHVLQ1HZSRUW %HDFKDQGEH\RQG ,,VWKLVDQHZRUH[LVWLQJSURMHFWSURJUDP"([LVWLQJSURJUDP )RUWKHVHDVRQ6RXWK&RDVW 5HSHUWRU\ಬV7KHDWUHIRU<RXQJ$XGLHQFHV7<$ SURJUDPZLOOFRQWLQXHLWVFRPPLWPHQWWR SURYLGLQJKLJKTXDOLW\WKHDWUHH[SHULHQFHVDQG DUWVHGXFDWLRQWR\RXQJDXGLHQFHVLQ1HZSRUW %HDFKZLWKSDUWLFXODUDWWHQWLRQWRVWXGHQWVIURP XQGHUVHUYHGFRPPXQLWLHV7KH7<$SURGXFWLRQ RI&LQGHUHOOD$6DOVD)DLU\7DOHZLOOEHRIIHUHG IUHHRIFKDUJHWRHOHPHQWDU\VFKRROVLQWKH 1HZSRUW0HVD8QLILHG6FKRRO'LVWULFWHQVXULQJ WKDW7LWOHVWXGHQWVKDYHDFFHVVWRSURIHVVLRQDO WKHDWUH +HDYLO\VXEVLGL]HGSDLGSHUIRUPDQFHVZLWK DIIRUGDEOHWLFNHWVVWDUWLQJDWZLOODOVREH DYDLODEOHWRWKHJHQHUDOSXEOLFH[WHQGLQJWKH UHDFKRIWKHSURJUDPWRIDPLOLHVDQGFKLOGUHQ WKURXJKRXW1HZSRUW%HDFK7KURXJKD FRPELQDWLRQRIIUHHVFKRROGD\PDWLQHHV WUDQVSRUWDWLRQVXEVLGLHVDQGDFFHVVLEOHSXEOLF SHUIRUPDQFHV7<$HQVXUHVHTXLWDEOH SDUWLFLSDWLRQIRU\RXQJSHRSOHUHJDUGOHVVRI VRFLRHFRQRPLFVWDWXV ,QWRWDO6&5DQWLFLSDWHVVHUYLQJDSSUR[LPDWHO\ LQGLYLGXDOVWKURXJK7<$SHUIRUPDQFHVLQ ZLWKQHDUO\RIDWWHQGHHVEHLQJ HOHPHQWDU\VFKRROVWXGHQWVLQ1HZSRUW%HDFK 7KHSURGXFWLRQGLUHFWO\WDUJHWVFKLOGUHQLQJUDGHV .ದHPSKDVL]LQJLQFOXVLYLW\DQGDFFHVVIRU VWXGHQWVZKRPLJKWQRWRWKHUZLVHKDYHWKH RSSRUWXQLW\WRHQJDJHZLWKOLYHWKHDWUH%\ RIIHULQJELOLQJXDOFXOWXUDOO\UHVSRQVLYH SURGXFWLRQVOLNH&LQGHUHOOD$6DOVD)DLU\7DOH 'HILQHRUGHVFULEHWKHVHJPHQWRIWKH SRSXODWLRQLQ1HZSRUW%HDFKWKDW\RXLQWHQGWR VHUYHE\\RXUSURMHFWSURJUDP,QFOXGHVXFK WKLQJVDVDJHORFDWLRQQXPEHUVVHUYHGHWF 6 of 25 153 6&5DOVRSURYLGHVH[SRVXUHWRGLYHUVH ODQJXDJHVVWRU\WHOOLQJWUDGLWLRQVDQGVRFLDO HPRWLRQDOOHDUQLQJKHOSLQJVWXGHQWVGHYHORS FXOWXUDODZDUHQHVVDQGUHVSHFW 7KURXJKWKHVHHIIRUWV6&5ಬV7<$SURJUDP FRQWLQXHVWRIRVWHUDOLIHORQJDSSUHFLDWLRQIRUWKH DUWVZKLOHSURYLGLQJPHDQLQJIXOHGXFDWLRQDO HQULFKPHQWIRUFKLOGUHQDQGIDPLOLHVDFURVV 1HZSRUW%HDFK 3352-(&7%8'*(7([SHQVHV3HUVRQQHO $UWLVWLF )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV $GPLQLVWUDWLYH )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 7HFKQLFDO3URGXFWLRQ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 352-(&7%8'*(7([SHQVHV2SHUDWLQJ )DFLOLW\([SHQVH6SDFH5HQWDO )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 0DUNHWLQJ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 3URGXFWLRQ([KLELWLRQ([SHQVH )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK 7 of 25 154 ))XQGLQJIURP2WKHU6RXUFHV 7RXULQJ3UHVHQWDWLRQ([SHQVH )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV (GXFDWLRQ0DWHULDOV )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 7UDQVSRUWDWLRQ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV (TXLSPHQW )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 2WKHULIJUHDWHUWKDQDQQRWDWHEHORZ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV *5$1'727$/ 6RXWK&RDVW5HSHUWRU\ಬV7KHDWUHIRU<RXQJ $XGLHQFHV7<$SURJUDPIRUWKH VHDVRQZLOOSUHVHQW&LQGHUHOOD$6DOVD)DLU\ 7DOHDSURIHVVLRQDOO\VWDJHGELOLQJXDOIDPLO\ PXVLFDOGHVLJQHGWRHQJDJH\RXQJDXGLHQFHV ZKLOHSURPRWLQJFUHDWLYLW\FXOWXUDODZDUHQHVV DQGVRFLDOHPRWLRQDOOHDUQLQJ7KHIROORZLQJ TXDQWLILDEOHRXWFRPHVDUHH[SHFWHG ,QWURGXFHVWXGHQWVWRWKHWUDQVIRUPDWLYHSRZHURI OLYHWKHDWUH%\SURYLGLQJIUHHVFKRROGD\ PDWLQHHVWRDSSUR[LPDWHO\HOHPHQWDU\ VWXGHQWV7<$ZLOOJLYHVWXGHQWVDQHQULFKLQJ LQWURGXFWLRQWRSURIHVVLRQDOWKHDWUHVWRU\WHOOLQJ 'HVFULEHWKHH[SHFWHGTXDQWLILDEOHRXWFRPHV RI\RXUSURMHFWSURJUDPDQGKRZ\RXZLOO HYDOXDWHWKHUHVXOWV%HYHU\VSHFLILFLQ DGGUHVVLQJWKHZD\VWKDW\RXZLOOGHWHUPLQHWKDW \RXUSURMHFWSURJUDPPHWWKHQHHGVWKDW\RX LGHQWLILHGDQGDFFRPSOLVKHVWKHJRDOV\RXVHWRXW WRDFKLHYHLH\RXSURYLGHKRXUVRIPXVLFDO LQVWUXFWLRQDQGLQVWUXPHQWVWRWKHFKLOGUHQDW 1HZSRUW(OHPHQWDU\VFKRRODVPHDVXUHGE\ PXVLFVWRUHUHQWDOUHFHLSWVDQGORJVRI LQVWUXFWRUV 8 of 25 155 DQGPXVLFDOSHUIRUPDQFH 3URPRWHFXOWXUDODQGOLQJXLVWLFOHDUQLQJ7KH ELOLQJXDOQDWXUHRIWKHSURGXFWLRQZLOOH[SRVH VWXGHQWVWRERWK(QJOLVKDQG6SDQLVKODQJXDJH GLDORJXHHQFRXUDJLQJHDUO\ODQJXDJH UHFRJQLWLRQFURVVFXOWXUDOXQGHUVWDQGLQJDQG UHVSHFWIRUGLYHUVHYRLFHV 6XSSRUWVRFLDOHPRWLRQDOOHDUQLQJWKURXJK WKHDWUH7KHSURGXFWLRQಬVWKHPHVLQFOXGH WHDPZRUNVSRUWVPDQVKLSDQGUHVSHFW7KLVZLOO UHLQIRUFHLPSRUWDQWOLIHVNLOOVLQDQHQJDJLQJDQG PHPRUDEOHZD\ )RVWHUOLIHORQJDSSUHFLDWLRQIRUWKHDUWV%\ RIIHULQJERWKIUHHDQGSXEOLFSHUIRUPDQFHV7<$ HQVXUHVWKDWVWXGHQWVDQGIDPLOLHVFDQ H[SHULHQFHKLJKTXDOLW\WKHDWUHHQFRXUDJLQJ RQJRLQJSDUWLFLSDWLRQLQDQGDSSUHFLDWLRQIRUWKH DUWV (YDOXDWLRQ0HWKRGV $WWHQGDQFH7UDFNLQJ0RQLWRUWKHQXPEHURI VWXGHQWVDWWHQGLQJVFKRROGD\PDWLQHHV LQFOXGLQJ7LWOHVFKRROVLQ1HZSRUW0HVD8QLILHG 6FKRRO'LVWULFW 7HDFKHU 6XUYH\VDQG)HHGEDFN&ROOHFWIHHGEDFNIURP WHDFKHUVRQKRZWKHSHUIRUPDQFHHQKDQFHG FODVVURRPOHDUQLQJVXSSRUWHGELOLQJXDORU FXOWXUDOFXUULFXOXPDQGLPSDFWHGVWXGHQW HQJDJHPHQW 7LFNHW6DOHVDQG3XEOLF$WWHQGDQFH7UDFNSDLG DXGLHQFHSDUWLFLSDWLRQWRJDXJHEURDGHU 9 of 25 156 FRPPXQLW\HQJDJHPHQWDQGLQWHUHVWLQIDPLO\ IULHQGO\DUWVH[SHULHQFHV 7UDQVSRUWDWLRQ6XEVLG\8WLOL]DWLRQ0HDVXUHWKH QXPEHURI7LWOHVFKRROVXVLQJEXVVXEVLGLHVWR UHPRYHEDUULHUVWRDWWHQGDQFH 7KURXJKWKHVHPHWULFV6&5ZLOOHQVXUHWKDW &LQGHUHOOD$6DOVD)DLU\7DOHDFKLHYHVERWKLWV DUWLVWLFDQGHGXFDWLRQDOREMHFWLYHV7KH FRPELQDWLRQRIVWXGHQWHQJDJHPHQWFXOWXUDO H[SRVXUHVRFLDOHPRWLRQDOOHDUQLQJDQG FRPPXQLW\SDUWLFLSDWLRQZLOOVHUYHDVWKHEDVLV IRUHYDOXDWLQJWKHVXFFHVVRIWKHSURJUDPDQG UHILQLQJIXWXUH7<$RIIHULQJV //LVWRI%RDUG0HPEHUVDQGWKHLUDIILOLDWLRQV 5HFHQWOLVWRILQGLYLGXDOVFRUSRUDWLRQVDQG IRXQGDWLRQVWKDWSURYLGHRUJDQL]DWLRQDOVXSSRUW ,56'HWHUPLQDWLRQ/HWWHULI\RXDUHD FbLQGLFDWLQJWD[H[HPSWVWDWXV 2QHEURFKXUHDQGRURQHSUHVVFOLSSLQJ , ,QFRPHFDVKRQO\ &RQWULEXWHG )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG (DUQHG )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 7RWDO,QFRPH )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG ,, ([SHQVHV 10 of 25 Document found on page 13-14. Document found on page 15. Document found on pages 16-17. Document found on pages 18-25. 157 33URJUDP )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG *HQHUDODQG$GPLQLVWUDWLYH )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 0DUNHWLQJDQG'HYHORSPHQW )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 7RWDO([SHQVHV )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG ,WHP ,,, 2SHUDWLQJ6XUSOXV'HILFLW,QFRPHPLQXV([SHQVHV )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG ,9 )XQG%DODQFHDW%HJLQQLQJRI<HDU )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 9 $FFXPXODWHG6XUSOXV'HILFLW$GGOLQHV,,,DQG,9 )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG ,WHP 9, ,Q.LQG&RQWULEXWLRQVDWWDFKVFKHGXOHVLIJUHDWHUWKDQRIWRWDOLQFRPH )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 11 of 25 158 ,,YHULI\\WKHHNQRZOHGJHHWKDWWWKHHLQIRUPDWLRQQ VXEPLWWHGGLQQWKLVVDSSOLFDWLRQQLVVWUXHHDQGGFRUUHFWWWRR WKHHEHVWWRIIP\\NQRZOHGJH 1DPH (PLO\7KH\V 7LWOH *UDQWV0DQDJHU /DVWW8SGDWH 6WDUWW7LPH )LQLVKK7LPH 3RZHUHGE\)RUPVLWH12 of 25 159 SOUTH COAST REPERTORY Board of Trustees 2025-26 Name Professional Affiliation Years on Board Talya Nevo-Hacohen, President Chief Investment Officer and Executive V.P., Sabra Health Care REIT, Tustin 9 Michael R. Hards, VP Advancement Community Leader, Orange 9 Bruce Wagner, VP Finance Community Leader, Orange 7 Timothy J. Kay, VP Development Partner, Snell & Wilmer LLP, Costa Mesa 4 Giulia Newton, VP Community Relations Community Leader, Irvine 3 Suzanne Appel Managing Director, SCR, Costa Mesa 1 Shauna Bradford Managing Director/Treasury Sales Manager, Bank of America, Newport Beach NEW David A. Chase Vice President & Associate General Counsel, Skyworks Solutions, Irvine 1 Sophia Hall Cripe Community Leader, Newport Beach 7 Laura Cushing Chief Human Resources Officer, Pacific Life Insurance, Newport Beach NEW David M. Emmes Founding Artistic Director, SCR, Costa Mesa 53 Susan K. Hori Partner, Manatt, Phelps & Phillips LLC, Costa Mesa 1 David Ivers Artistic Director, SCR, Costa Mesa 7 Lea Kong Community Leader, Foothill Ranch 6 Sarah McElroy Community Leader, Corona Del Mar NEW Tara Netherton Market Executive, JP Morgan Chase, Irvine 7 Regina Oswald Designer/Founder & CEO, Regina Oswald LLC, Santa Ana 1 13 of 25 160 SOUTH COAST REPERTORY Board of Trustees 2025-26 Name Professional Affiliation Years on Board Mark D. Peterson Partner, O’Melveny & Myers LLP, Newport Beach 5 Susan Shieldkret Community Leader, Los Angeles 7 Tammy Tang Community Leader, Corona Del Mar 1 Ernesto Vasquez Partner & CEO, SVA Architects, Santa Ana 6 Julia Voce Community Leader, Seal Beach 2 Nickie Williams Community Leader, Fallbrook 2 Felix Yan Executive Director, JP Morgan Private Bank, Irvine 5 14 of 25 161 >Z^,/W'/s/E' ^ŽƵƚŚŽĂƐƚZĞƉĞƌƚŽƌǇŝƐƉůĞĂƐĞĚƚŽƌĞĐŽŐŶŝǌĞĂŶĚƚŚĂŶŬŽƵƌŐĞŶĞƌŽƵƐŵĂũŽƌĚŽŶŽƌƐ͘dŚĞĨŽůůŽǁŝŶŐ ŝŶĐůƵĚĞƐĚŽŶŽƌƐǁŚŽŚĂǀĞĐŽŶƚƌŝďƵƚĞĚΨϭϬ͕ϬϬϬŽƌŵŽƌĞĐƵŵƵůĂƚŝǀĞůǇƚŽ^Z͛ƐŶŶƵĂů&ƵŶĚ͕ŝŶĐůƵĚŝŶŐ ƐƉĞĐŝĂůĞǀĞŶƚĨƵŶĚƌĂŝƐĞƌƐŝŶƚŚĞƉĂƐƚǇĞĂƌ͘DĂŶǇĚŽŶŽƌƐůŝƐƚĞĚďĞůŽǁŚĂǀĞƐĞƌǀĞĚĂƐ^ĞĂƐŽŶ^ƉŽŶƐŽƌƐ͕ ,ŽŶŽƌĂƌǇWƌŽĚƵĐĞƌƐ͕EĞǁtŽƌŬ^ƉŽŶƐŽƌƐ͕WůĂǇǁƌŝŐŚƚƐŝƌĐůĞŵĞŵďĞƌƐĂŶĚĚƵĐĂƚŝŽŶ^ƉŽŶƐŽƌƐ͘ ΨϭϬϬ͕ϬϬϬEKs ƉƌŝĞŵĚǀŝƐŽƌƐ :ƵůŝĂŶŶĞΘ'ĞŽƌŐĞƌŐǇƌŽƐͬƌŐǇƌŽƐ&ĂŵŝůǇ &ŽƵŶĚĂƚŝŽŶ dŚĞEŝĐŚŽůĂƐŶĚŽǁŵĞŶƚ DŝĐŚĂĞůZĂǇ dŚĞ^ĞŐĞƌƐƚƌŽŵ&ŽƵŶĚĂƚŝŽŶ dŚĞ^ŚƵďĞƌƚ&ŽƵŶĚĂƚŝŽŶ ^ĂŵƵĞůΘdĂŵŵǇdĂŶŐ ΨϱϬ͕ϬϬϬdKΨϵϵ͕ϵϵϵ ZŝĐŚĂƌĚΘ>ŝƐĂĚĞ>ŽƌŝŵŝĞƌ >ĂƵƌŝĞΘ^ƚĞǀĞƵŶĐĂŶ dŚĞ,ĂƌŽůĚĂŶĚDŝŵŝ^ƚĞŝŶďĞƌŐŚĂƌŝƚĂďůĞdƌƵƐƚ dĂůǇĂEĞǀŽͲ,ĂĐŽŚĞŶΘŝůů^ĐŚĞŶŬĞƌ ^ĂŵƵĞůŝ&ŽƵŶĚĂƚŝŽŶ ůŝǌĂďĞƚŚ^ĞŐĞƌƐƚƌŽŵ ^ƵƐĂŶ^ŚŝĞůĚŬƌĞƚΘĂǀŝĚƵůů h͘^͘ĂŶŬ ^ŽĐŽƌƌŽΘƌŶĞƐƚŽsĂƐƋƵĞǌ ΨϮϱ͕ϬϬϬdKΨϰϵ͕ϵϵϵ ŶŽŶǇŵŽƵƐ >ĞŽŶĂƌŽŶŽĨĨͲ^ĂĚĂĐĐĂ ĂŶŬŽĨŵĞƌŝĐĂ ^ŽƉŚŝĞΘ>ĂƌƌǇƌŝƉĞ :ĂŵĞƐΘZŚŽŶĚĂƵĐŽƚĞ KĨĨŝĐĞŽĨKƌĂŶŐĞŽƵŶƚǇ^ƵƉĞƌǀŝƐŽƌ<ĂƚƌŝŶĂ &ŽůĞǇ ůŝǌĂďĞƚŚ'ĞŽƌŐĞ&ŽƵŶĚĂƚŝŽŶ ůĂŝŶĞΘDŝŬĞ'ƌĂǇ ĚƌŝĂŶΘ<ƌŝƐƚĞŶ'ƌŝŐŐƐ ,ĂƐŬĞůůΘtŚŝƚĞ>>W ^ƵƐĂŶ<͘,Žƌŝ dŝŵΘDĂƌŝĂŶŶĞ<ĂǇ ^ĂƌĂŚ:͘DĐůƌŽǇ ^ƚĞƉŚĞŶ'͘ĂŶĚZĞŐŝŶĂKƐǁĂůĚ&ŽƵŶĚĂƚŝŽŶ WĂĐŝĨŝĐ>ŝĨĞ&ŽƵŶĚĂƚŝŽŶ ^ĂďƌĂ,ĞĂůƚŚĂƌĞZ/d WĞƚĞƌΘ:ŽǇ^ůŽĂŶ :ƵůŝĂsŽĐĞ :ĞĂŶΘdŝŵtĞŝƐƐ :ƵĚǇΘtĞƐtŚŝƚŵŽƌĞ EŝĐŬŝĞΘDŝĐŬĞǇtŝůůŝĂŵƐ Ψϭϱ͕ϬϬϬdKΨϮϰ͕ϵϵϵ ŶŽŶǇŵŽƵƐ dŚĞ^ŚĞƌŝĂŶĚ>ĞƐŝůůĞƌ&ĂŵŝůǇ&ŽƵŶĚĂƚŝŽŶ ĂƉŝƚĂů'ƌŽƵƉ DŝĐŚĂĞůΘ:ĂŶĞƚ,ĂƌĚƐ ZŝĐŚĂƌĚ,ĞƐƐ WĂƚƌŝĐŝĂ,ŽƵƐƚŽŶ ,ĂŶƐΘsĂůĞƌŝĞ/ŵŚŽĨ ^ĐŚĂůŽŶΘ'ŝƵůŝĂEĞǁƚŽŶ KŶĞZŽŽƚ&ŽƵŶĚĂƚŝŽŶ <ĞůůǇΘŽƌZƵŝƚĞŶ ^ŽƵƚŚŽĂƐƚWůĂǌĂ ΨϭϬ͕ϬϬϬdKΨϭϰ͕ϵϵϵ ĂŶƚĞƌďƵƌǇŽŶƐƵůƚŝŶŐ ĂǀŝĚΘ<ŝŵďĞƌůǇŚĂƐĞ ĂǀŝĚΘ^ƵǌĂŶŶĞŚŽŶĞƚƚĞ ^ĂŶĚǇ^ĞŐĞƌƐƚƌŽŵĂŶŝĞůƐ DĂƌŐĂƌĞƚD͘'ĂƚĞƐ ^͘>ĞƐůŝĞ:ĞǁĞƚƚΘWĂƚƌŝĐŬWĂĚĚŽŶ ^ĐŽƚƚ:ŽƌĚĂŶ dŚĞ<ŽďƌŝŶ&ĂŵŝůǇ :ŽůĞŶĞΘDĂƌŬWĞƚĞƌƐŽŶ Dƌ͘ΘDƌƐ͘'ƌĞŐŽƌǇZĞŶĚĞ :ŽĞůΘ:ƵĚǇ^ůƵƚǌŬǇ :ĂŵĞƐ^ŽŵŵĞƌǀŝůůĞ :ŽŚŶΘDŝĐŚĞůůĞtŝůůŝĂŵƐ 'ƌĞŐŽƌǇĂƌĞƚ 15 of 25 162 16 of 25 163 17 of 25 164 STUDY GUIDE book by Madhuri Shekar music by Christian Magby lyrics by Christian Albright based on the book by Oliver Jeffers directed by H. Adam Harris 18 of 25 165 2 • SOUTH COAST REPERTORY• The Incredible Book Eating Boy T heatre is an art form that depends on both the artists and the audience. A performance is influenced by an audience, just as an audience is influenced by a performance. With this play, the artists and staff of South Coast Repertory have created a special new world for you. Sometimes that world is so exciting that you can barely hold still. But remember: once the play begins, you are connected to all the other people in the audience, as well as to the actors on the stage, because you’re all in the same room. The actors can see you, hear you and feel you, just as you can see, hear and feel them. Your attention, involvement, responses and imagination are a real part of each and every performance. The play can actually be made better because of you! STUDENT TIPS FOR THEATRE TRIPS •Stay with your group at all times and pay attention to your teachers and chaperones. •Take your seat in the theatre before going to the bathroom or getting a drink of water. •Make yourself comfortable while keeping movement to a minimum. •Do not stand up, walk around or put your feet on the seat in front of you. •Absolutely no chewing gum, eating or drinking in the building. •No backpacks, cameras or electronic devices are permitted in the theatre. •Feel free to talk quietly in your seats before the show. •Show your appreciation by clapping for the actors at the end of the play. •After the lights come back up, wait for the ushers to escort your group out of the theatre. THEATRE VOCABULARY • Backstage The space behind the acting area, unseen by the audience. • Blocking The movement designed by the director and performed by the actors. • Box Office A windowed space at the front of the theatre building where tickets are sold. • Choreography The art of creating and arranging dances onstage. • Cue The last words or action of an actor immediately preceding the lines or business of another actor. • Downstage The part of the stage closest to the audience. At one time, stages were raked, or sloped, with the lower (“down”) part closest to the audience, and the higher (“up”) part farther away. • Green Room A room near the stage where actors await entrance cues and receive guests. The room’s name comes from Elizabethan times, when actors waited on a real “green” (or patch of grass). • Matinee A morning or afternoon performance of a play. • Props All the hand-held items and stage furnishings, including furniture, that are physically used by the actors. • Rehearsal Time performers use to practice privately before a performance in front of an audience. • Script The text of the play, including dialogue and stage directions, all written by the playwright. • Upstage The area of the stage farthest away from the audience and nearest to the back wall. Welcome to the Theatre 19 of 25 166 The Incredible Book Eating Boy •SOUTH COAST REPERTORY •3 It’s the first day of third grade, and eight-year- old Henry is feeling queasy. His friends, Jeff and Olivia, think third grade is where it’s at, and Ms. Penny, their new teacher, seems super nice. But for Henry, there’s one big problem—there are no books with pictures in the third grade. Henry hates reading books, especially the ones that have too many words in them! After a frustrating first day at school, Henry feels behind already and doesn’t know what to do. That is until he sees his dog, Rover, swallow a book whole and—miraculously—start to speak in English. Henry is surprised to say the least, but then he decides to give it a try himself. He eats a page of his math textbook, and once he does, he’s suddenly ready for the big test the next day. Henry doesn’t stop at just one book, though. He begins eating all his textbooks, and his new diet puts him at the top of his class. The more books he eats, the more facts he has at his fingertips. The Louisiana Purchase? Henry knows all about that. Newton’s Law of Gravity? Easy to explain. The lifespan of a tortoise? Who doesn’t know that they can live nearly 200 years?! Henry certainly does. He knows everything. He’s the Incredible Book Eating Boy! But after a while, Henry’s eating habits start to cause some problems. Without realizing it, Henry has eaten all the books in the classroom, and now there are none left for the other students to read. Even worse, Henry’s stomach hasn’t been feeling all that well. In fact, it feels awful— awful enough to throw up. And when Henry does, papers go flying everywhere! The doctor writes Henry a prescription: No more eating books. That’s the best way to avoid the jumbly-wumblies, the medical term for what happens when someone eats too many books. Unfortunately, that leaves Henry in his original predicament, with books all around him and no way to absorb the information. There’s only one thing left for Henry to try…and that’s reading. The reading is slow going at first, but soon Henry discov- ers that everyone approaches reading a little bit differently and that everyone likes reading different things. Henry likes comic books, for example, specifically the way they combine text, pictures, and imagination. By the time he reaches the fourth grade, Henry has fallen in love with books. Not eating them but reading them. THE STORY OF THE INCREDIBLE BOOK EATING BOY The Play Did you know The Incredible Book Eating Boy is inspired by an award-winning picture book of the same name, written and illustrated by Oliver Jeffers? It was first published in 2006 and won the 2007 Irish Book Award for Children’s Book of the Year. The musical adaptation is written by Madhuri Shekar, with music and lyrics by Christian Magby and Christian Albright. It received its world premiere production in 2022 at the Alliance Theatre in Atlanta, Georgia. 20 of 25 167 4 • SOUTH COAST REPERTORY• The Incredible Book Eating Boy Classroom Activities BEFORE THE SHOW 1. Have your students read The Incredible Book Eating Boy on their own—or read it aloud as a class. (A link to the full text can be found on the Resources page of this study guide.) After reading, ask your student to: a. Recall the plot’s main events. b. Identify the story’s themes and underlying messages. c. Discuss the book’s artwork. What did author and illustrator Oliver Jeffers use as his canvas? 2. Henry likes eating books (which probably don’t taste very good!). What’s your favorite food? 3. Henry doesn’t like to read at first, but by the end of the book, he loves it. What’s your favorite genre of book and why? 4. Discuss the difference between fiction and drama and explore what it means to “adapt” a book into a musical. 5. Have the students talk about how they think the story of The Incredible Book Eating Boy will be brought to life in South Coast Repertory’s musical stage version. a. What might the scenery on stage look like? b. What about the costumes? c. What do you think the songs will sound like? 6. Discuss the different jobs involved to bring a production like The Incredible Book Eating Boy to life. Have the students research the occupations on the list below and share what they find with the class. a. Actor b. Director c. Playwright d. Composer e. Lyricist f. Music Director g. Choreographer h. Designer i. Stage Manager j. Stage Crew 21 of 25 168 The Incredible Book Eating Boy • SOUTH COAST REPERTORY •5 WORDS! WORDS! WORDS! Listen for the following words during the performance. Amalgamation: (noun) the process or result of joining or bringing together two or more things Dissertation: (noun) a long document about a certain topic Hassle: (verb) to bother or pester Predilection: (noun) a preference or liking for something Gastronomical: (adjective) relating to the art or science of good eating Logically: (adverb) in a way that is clear and makes sense Fortified: (adjective) improved or enhanced through the addition of ingredients, such as vitamins Ironic: (adjective) when something happens in the opposite way to what’s ex- pected Culprit: (noun) someone guilty of a crime or fault Compulsive: (adjective) resulting from an irresistible urge Perspective: (noun) a point of view or a particular attitude towards something Peers: (noun) those belonging to the same group, often based on age or grade in school Can you unscramble these words from the list to the left? (Answers on page 8.) 1. Ticmlasonogar 2. Seper 3. Trsitisaedno 4. Ifftedior 5. Aagnmalotaim 6. Cluprti 7. Vcmlspueoi 8. Ptsiereecpv 9. Elencodiprti 10. Ashsel 11. Liglyloca 12. Nrciio WORD SEARCH Can you spot all the words from the list above? They can be found in all direc- tions—vertically, horizon- tally, and even diagonally. (Some words are listed back- wards, too!) EHRAOHRIWBQAXWQ VJDPMUASHIMYESH IHWKELYSPAFSLOK SBEZYFALLEFOKXN LCINORIGGOLOMOI UONOITATRESSIDX PGGAUMITDMBTSOS MPCIAGIRDOCUWAO OXETCFBXPEYWYTH CAIEIAMYLLITDHI YOLERQLIIUUXNCL NFDXDSDLOPPCJAU MHIDIEJWYKMMMKD GASTRONOMICALYW HHPPERSPECTIVEP 22 of 25 169 6 • SOUTH COAST REPERTORY• The Incredible Book Eating Boy AFTER THE SHOW Discussion about the Theatre When you return from the performance, hold a class discus- sion and ask the students about their experience attending live theatre. 1. What was the first thing you noticed about the theatre? What did the stage look like? 2. Discuss the technical elements of the production— the sets, costumes, lights, and sound. Ask the students what they liked best and why. How did these elements create and define Henry’s world? 3. The original book inspired the overall production design for the play. What similarities or differences did you notice? 4. In musicals, characters express themselves through music and movement. How did the songs help move the story forward? How did the choreography show you the differences between the characters? 5. How is attending a live performance different from attending a movie? How does your experience change when you know the story is being performed live and the actors can see and hear you? Discussion about the Play 1. What was your favorite moment in the play? What was the funniest? What was the most surprising? 2. Ms. Penny encourages Henry to take his time and not rush when reading. Can you think of a time when a teacher helped you overcome a challenge? 3. Henry develops a habit of eating books. Have you ever had to break a bad habit? What steps did you take to stop? 4. Henry discovers he loves knowing things. What is your favorite school subject and why? 5. Transitioning from one grade to the next can be scary but also exciting. Name three things you are looking forward to next school year. ACTIVITIES 1. Pictures in Your Mind: Henry learns that one way to overcome his fear of reading is to use his imagination. Use the space below to draw an image inspired by the musical you just saw. ok Eating Boy red the overall production at similarities or differences express themselves through How did the songs ward? How did the u the differences between performance g a movie? How hange when you performed live nd hear you? hat saw. 23 of 25 170 The Incredible Book Eating Boy •SOUTH COAST REPERTORY •7 2. Cooking & Writing: Henry’s favorite activity is cooking and eating with his family. At home, ask a caregiver to teach you a family recipe step-by-step. As you go through each step, write it down in your own words. Keep it or share it with your friends! 3. How many books did you read in 2024? Picture books count! List them below: LETTERS OF THANKS W rite a letter of thanks to SCR and de- scribe the most memorable aspects of attending a performance of The Incredible Book Eating Boy. South Coast Repertory Attn: TYA PO Box 2197 Costa Mesa, CA 92628-2197 TITLE AUTHOR 1-3 Books: GREAT!3-6 Books: AMAZING! 6+Books: INCREDIBLE 24 of 25 171 8 • SOUTH COAST REPERTORY • The Incredible Book Eating Boy MORE ABOUT THE INCREDIBLE BOOK EATING BOY PICTURE BOOK The full text of The Incredible Book Eating Boy: https://www.orange.k12.nj.us/cms/lib/NJ01000601/Centricity/Domain/1020/The%20Incredible%20Book%20 Eating%20Boy.pdf MORE ABOUT AUTHOR AND ILLUSTRATOR OLIVER JEFFERS Official website: https://oliverjeffers.com/ MORE ABOUT PLAYWRIGHT MADHURI SHEKAR Official website: https://www.madhurishekar.com/ OTHER STUDY GUIDES Alliance Theatre study guide for The Incredible Book Eating Boy: https://www.alliancetheatre.org/sites/default/files/BEB-studyguide-k-5-v2.pdf WORD SCRAMBLE ANSWER KEY: WORD SCRAMBLE ANSWER KEY: Resources 1.Gastronomical 2.Peers 3.Dissertation 4.Fortified 5.Amalgamation 6.Culprit 7.Compulsive 8.Perspective 9.Predilection 10.Hassle 11.Logically 12.Ironic EHRAOHRIWBQAXWQ VJDPMUASHIMYESH IHWKELYSPAFSLOK SBEZYFALLEFOKXN LCINORIGGOLOMOI UONOITATRESSIDX PGGAUMITDMBTSOS MPCIAGIRDOCUWAO OXETCFBXPEYWYTH CAIEIAMYLLITDHI YOLERQLIIUUXNCL NFDXDSDLOPPCJAU MHIDIEJWYKMMMKD GASTRONOMICALYW HHPPERSPECTIVEP 25 of 25 172 South Coast Repertory CINDERELLA: A SALSA FAIRY TALE 2025/26 Season Newport-Mesa Unified School District Proposed Elementary Schools Served Adams Anderson California College Park Davis Eastbluff Estancia Harbor View Kaiser Killybrooke Lincoln Newport Coast Newport El Newport Heights Paularino Rea Sonora Victoria Whittier Wilson Woodland 173 &&XOWXUDO$UWV*UDQWV$SSOLFDWLRQ)RUP 5HIHUHQFH 6WDWXV &RPSOHWH /RJLQ8VHUQDPH $]L#:LOGOLIH-HZHOVRUJ /RJLQ(PDLO $]L#:LOGOLIH-HZHOVRUJ 3RSXODU1DPHRI2UJDQL]DWLRQ :LOGOLIH-HZHOV /HJDO1DPHLIGLIIHUHQW:LOGOLIH-HZHOV )HGHUDO7D[,'1R 0DLOLQJ$GGUHVV ZKLWHZDWHUGULYH &LW\=LSFRGH &2521$'(/0$5 &RQWDFW1DPH $]L6KDULI 3KRQHQXPEHU (PDLODGGUHVV $]L#:LOGOLIH-HZHOVRUJ :HEVLWH KWWSVZZZZLOGOLIHMHZHOVRUJ *HRJUDSKLFDO$UHD6HUYHG 1HZSRUW%HDFK&DOLIRUQLD +DYH\RXUHFHLYHGD&LW\RI1HZSRUW%HDFK &XOWXUDO$UWV*UDQWEHIRUH" 1R ,IVRZKDW\HDUGLG\RXUHFHLYHDJUDQW"1$ <HDURUJDQL]DWLRQZDVIRXQGHG 1XPEHURISDLGVWDII 1XPEHURIDFWLYHYROXQWHHUV 7RWDODPRXQWUHTXHVWHGIURPUHTXHVWOLQHRI SURMHFWEXGJHW (VWLPDWHGQXPEHURISHRSOHLQ1HZSRUW%HDFK WKDWWKHSURSRVHGSURMHFWVZLOOVHUYH :LOGOLIH-HZHOVLVD1HZSRUW%HDFKದEDVHG QRQSURILWDUWVDQGHGXFDWLRQRUJDQL]DWLRQWKDW %ULHIO\GHVFULEHEHORZ\RXURUJDQL]DWLRQ V SXUSRVHPLVVLRQDQGJRDOV ATTACHMENT H 174 HQJDJHVWKHFRPPXQLW\WKURXJKYLVXDODUWV FUHDWLYHOHDUQLQJDQGSXEOLFFXOWXUDO SURJUDPPLQJLQVSLUHGE\ORFDOZLOGOLIHDQG QDWXUH7KURXJKKDQGVRQDUWZRUNVKRSVDQG H[KLELWLRQVZHSURYLGHDFFHVVLEOHRSSRUWXQLWLHV IRUSHRSOHRIDOODJHVWRH[SORUHFUHDWLYLW\EXLOG DUWLVWLFVNLOOVDQGFRQQHFWZLWK1HZSRUW%HDFKಬV VHQVHRISODFHWKURXJKDUW2XUJRDOVDUHWR H[SDQGDFFHVVWRKLJKTXDOLW\YLVXDODUWV H[SHULHQFHVIRVWHULQFOXVLYHFRPPXQLW\ SDUWLFLSDWLRQLQWKHDUWVDQGSUHVHQWSXEOLF SURJUDPVDQGH[KLELWLRQVWKDWUHIOHFWDQG FHOHEUDWHWKHXQLTXHFRDVWDOZLOGOLIHDQGQDWXUDO HQYLURQPHQWRI1HZSRUW%HDFK 1HZSRUW%HDFKUHVLGHQWVYDOXHFXOWXUDO SURJUDPPLQJDQGWKHUHLVDFOHDURSSRUWXQLW\WR H[SDQGIUHHSDUWLFLSDWRU\YLVXDODUWVH[SHULHQFHV WKDWDUHDFFHVVLEOHWRDOODJHVDQGH[SHULHQFH OHYHOV:KLOHWKH&LW\RIIHUVVWURQJFXOWXUDO YHQXHVDQGHYHQWVDGGLWLRQDOKDQGVRQYLVXDO DUWVSURJUDPVWKDWLQYLWHUHVLGHQWVWRDFWLYHO\ FUHDWHDQGFROODERUDWHLQFLYLFVSDFHVKHOS EURDGHQDFFHVVDQGFRPPXQLW\SDUWLFLSDWLRQ %DVHGRQ:LOGOLIH-HZHOVಬUHFHQWFRPPXQLW\DUW DFWLYLWLHVLQ1HZSRUW%HDFKIUHHZRUNVKRSV W\SLFDOO\HQJDJHದSDUWLFLSDQWVSHUVHVVLRQ DQGSXEOLFIDFLQJDUWHYHQWVRIWHQGUDZRU PRUHFRPPXQLW\PHPEHUVGHPRQVWUDWLQJVWURQJ GHPDQGIRUDFFHVVLEOHFRPPXQLW\FHQWHUHG YLVXDODUWVSURJUDPPLQJ7KLVSURMHFWLVGHVLJQHG WRVHUYHDSSUR[LPDWHO\1HZSRUW%HDFK UHVLGHQWVWKURXJKWKUHHFROODERUDWLYHZRUNVKRSV DQGDSXEOLFFRPPXQLW\VKRZFDVHHYHQW 1HZSRUW%HDFKಬVFRDVWDOZLOGOLIHDQG HQYLURQPHQWDUHFHQWUDOWRWKH&LW\ಬVLGHQWLW\DQG FRPPXQLW\IHHGEDFNVKRZVVWURQJLQWHUHVWLQ ,GHQWLI\DQGGHVFULEHZK\WKHUHLVDQHHGLQ WKH1HZSRUW%HDFK&RPPXQLW\IRU\RXU SURSRVHGSURMHFWSURJUDP,QFOXGHDTXDQWLWDWLYH GHVFULSWLRQRIWKHQHHGDQGRQZKDW\RXEDVHG \RXUILQGLQJVLHಯ%DVHGRQDVWXG\GRQHE\WKH 37$WKHUHDUHRQHKXQGUHGFKLOGUHQLQWKHWK WKJUDGHVDW1HZSRUW(OHPHQWDU\ZKRKDYHKDG QRWUDLQLQJZLWKPXVLFDOLQVWUXPHQWVರ'HVFULEH KRZ\RXKDYHGHWHUPLQHGWKDW\RXURUJDQL]DWLRQ LVWKHEHVWRUJDQL]DWLRQIRUWKHSURSRVHGSURMHFW SURJUDP 175 FUHDWLYHSURJUDPVWKDWUHIOHFWWKLVVHQVHRISODFH :LOGOLIH-HZHOVLVZHOOVXLWHGWRGHOLYHUWKLV SURMHFWGXHWRRXUH[SHULHQFHSURGXFLQJ FRPPXQLW\EDVHGYLVXDODUWVZRUNVKRSV LQFOXGLQJ\RXWKDQGIDPLO\SDLQWLQJSURJUDPV IDFLOLWDWLQJFROODERUDWLYHDUWPDNLQJDFURVVDJH JURXSVDQGSUHVHQWLQJSXEOLFDUWSURJUDPVLQ FLYLFVHWWLQJVZLWKFOHDUSURMHFWRUJDQL]DWLRQDQG VWURQJDUWLVWLFOHDGHUVKLS 3URMHFW7LWOH7KH$UWRI1HZSRUW%HDFK:LOGOLIH &RPPXQLW\3DLQWLQJ 6KRZFDVH 7KLVSURSRVDOUHTXHVWVVXSSRUWIRUDQHZYLVXDO DUWVSURJUDPFRQVLVWLQJRIWKUHHIUHHSXEOLF FROODERUDWLYHSDLQWLQJHYHQWVLQZKLFK1HZSRUW %HDFKUHVLGHQWVFROOHFWLYHO\FUHDWHWKUHHODUJH VFDOHDUWZRUNVRQWH[WLOHFDQYDVFXOPLQDWLQJLQD SXEOLFFRPPXQLW\VKRZFDVHHYHQW7KHSURMHFW SURPRWHVFRPPXQLW\LQYROYHPHQWDQG DZDUHQHVVRIWKHYLVXDODUWVZKLOHFHOHEUDWLQJ 1HZSRUW%HDFKಬVFRDVWDOZLOGOLIHDQGVHQVHRI SODFH 3URMHFW,PSOHPHQWDWLRQ 6WUXFWXUH(DFK SDLQWLQJHYHQWZLOOEHRSHQWRWKHSXEOLFDQGOHG E\:LOGOLIH-HZHOVWHDFKLQJDUWLVWV3DUWLFLSDQWVRI DOODJHVDQGH[SHULHQFHOHYHOVPD\DWWHQGRQHRU PXOWLSOHHYHQWV'XULQJHDFKHYHQWSDUWLFLSDQWV ZLOOSDLQWGLUHFWO\RQWRDVKDUHGODUJHIRUPDW WH[WLOHFDQYDVFRQWULEXWLQJLQGLYLGXDOHOHPHQWV WKDWWRJHWKHUIRUPDFRKHVLYHFRPPXQLW\ DUWZRUN7HDFKLQJDUWLVWVZLOOJXLGHFRPSRVLWLRQ WHFKQLTXHDQGFRORUSDOHWWHWRHQVXUHHDFK DUWZRUNLVYLVXDOO\XQLILHGDQGH[KLELWLRQUHDG\ :KLOH:LOGOLIH-HZHOVKDVH[SHULHQFHIDFLOLWDWLQJ FRPPXQLW\SDLQWLQJWKURXJKLWV3DLQWIRU:LOGOLIH SURJUDPPLQJWKLVSURMHFWLVQHZLQVFRSHDQG 'HVFULEHWKHVSHFLILFSURMHFWSURJUDPWKDWZLOO EHIXQGHGE\DFXOWXUDOJUDQW,QFOXGHKRZWKH SURSRVHGSURMHFWSURJUDPZLOOEHLPSOHPHQWHG DQGRXWOLQHDVFKHGXOHRUSURMHFWWLPHOLQHZLWK SODQQHGGDWHVDQGORFDWLRQV,GHQWLI\LQGLYLGXDOV DQGJURXSVLQYROYHGSDUWLFXODUO\DUWLVWVDQG SHUIRUPHUVDQGGHVFULEHWKHLUUROHVDQG UHVSRQVLELOLWLHV'HVFULEHWKHEDFNJURXQGDQG TXDOLILFDWLRQVRI\RXURUJDQL]DWLRQDQGNH\ SHUVRQQHOWREHLQYROYHGLQWKHSURJUDP 5HPHPEHUWKH&LW\IXQGVRQO\SURMHFWVDQG SURJUDPVQRWRSHUDWLQJH[SHQVHV7KHVH SURMHFWVDQGSURJUDPVPXVWSURPRWHFRPPXQLW\ LQYROYHPHQWDQGDZDUHQHVVRIWKHDUWVLQ 1HZSRUW%HDFK 176 GHVLJQFUHDWHGVSHFLILFDOO\IRU1HZSRUW%HDFKDV DFRKHVLYHWKUHHSDUWFROODERUDWLYHSDLQWLQJ SURJUDPZLWKDFXOPLQDWLQJSXEOLFSUHVHQWDWLRQ $UWZRUN7KHPHV (YHQW1HZSRUW%HDFK0DULQH &RDVWDO :LOGOLIHPDULQHOLIHDQGVHDELUGV (YHQW1HZSRUW%HDFK3ROOLQDWRUV 1DWLYH 3ODQWVEXWWHUIOLHVQDWLYHEHHV ELUGVDQGFRDVWDOIORUD (YHQW1HZSRUW%HDFK:LOGOLIH&RQQHFWLRQV RSHQVWXGLRDQGILQLVKLQJVHVVLRQLQFRUSRUDWLQJ ZLOGOLIHDFURVVODQGDQGVHD 6FKHGXOH /RFDWLRQV$OOZLWKLQ1HZSRUW%HDFK $SULO2XWUHDFKUHJLVWUDWLRQDQGPDWHULDOV SUHSDUDWLRQ (YHQW-XQH (YHQW-XO\ (YHQW$XJXVWDOLJQHGZLWK1HZSRUW %HDFK$UW:HHN &RPPXQLW\6KRZFDVH(YHQW2FWREHU 3DLQWLQJHYHQWVZLOOEHKHOGDWDFFHVVLEOH 1HZSRUW%HDFKFLYLFDQGFRPPXQLW\YHQXHV VXFKDV&LW\FRPPXQLW\URRPVRUSDUNV7KH FRPPXQLW\VKRZFDVHHYHQWZLOOWDNHSODFHDWD FLYLFYHQXHVXFKDVWKH1HZSRUW%HDFK3XEOLF /LEUDU\RU&LYLF&HQWHUIDFLOLWLHVFRPPXQLW\URRP DQGRUSDUNVXEMHFWWRVFKHGXOLQJDQGYHQXH DSSURYDO,IYHQXHDYDLODELOLW\SHUPLWVWKH 177 DUWZRUNVPD\UHPDLQRQGLVSOD\IRUDVKRUW SHULRGIROORZLQJWKHHYHQW $UWLVWV 3HUVRQQHO7HDFKLQJ$UWLVWV/HDG 7HDFKLQJ$UWLVWUHVSRQVLEOHIRULQVWUXFWLRQDQG DUWLVWLFGLUHFWLRQVXSSRUWHGE\RQHSDLG$VVLVWDQW $UWLVWZKRDVVLVWVZLWKPDWHULDOVVHWXS SDUWLFLSDQWJXLGDQFHFROODERUDWLYHSDLQWLQJDQG FOHDQXS 3URMHFW/HDG&RRUGLQDWRU6FKHGXOLQJ RXWUHDFKPDWHULDOVSUHSDUDWLRQGRFXPHQWDWLRQ DQGFRRUGLQDWLRQRIWKHFRPPXQLW\VKRZFDVH HYHQWSURYLGHGDVLQNLQGVXSSRUW 9ROXQWHHU6XSSRUW:RUNVKRSVHWXSDQG EUHDNGRZQSDUWLFLSDQWFKHFNLQPDWHULDOV DVVLVWDQFHDQGVXSSRUWGXULQJWKHFRPPXQLW\ VKRZFDVHHYHQW 2UJDQL]DWLRQDO4XDOLILFDWLRQV :LOGOLIH-HZHOVLVD1HZSRUW%HDFKದEDVHG QRQSURILW DUWVDQGHGXFDWLRQRUJDQL]DWLRQZLWK H[SHULHQFHGHOLYHULQJFRPPXQLW\EDVHGYLVXDO DUWVSURJUDPVDQGSXEOLFDUWLQLWLDWLYHVIRUGLYHUVH DXGLHQFHVLQFOXGLQJ.VWXGHQWVDQGIDPLOLHV 2XURUJDQL]DWLRQEULQJVVWURQJDUWLVWLFOHDGHUVKLS DFFHVVLEOHSURJUDPGHVLJQDQGFOHDUSURMHFW FRRUGLQDWLRQHQVXULQJWKHVXFFHVVIXOGHOLYHU\RI WKLVFRPPXQLW\FHQWHUHGDUWVSURJUDP 7KLVSURSRVDOUHTXHVWVIXQGLQJRQO\IRUSURMHFW VSHFLILFFRVWVDQGLVGHVLJQHGWRH[SDQG FRPPXQLW\SDUWLFLSDWLRQDQGDZDUHQHVVRIWKH YLVXDODUWVLQ1HZSRUW%HDFK ,,VWKLVDQHZRUH[LVWLQJSURMHFWSURJUDP"1HZSURJUDP 'HILQHRUGHVFULEHWKHVHJPHQWRIWKH7KHSURMHFWZLOOVHUYH1HZSRUW%HDFKUHVLGHQWV 178 SSRSXODWLRQLQ1HZSRUW%HDFKWKDW\RXLQWHQGWR VHUYHE\\RXUSURMHFWSURJUDP,QFOXGHVXFK WKLQJVDVDJHORFDWLRQQXPEHUVVHUYHGHWF RIDOODJHVLQFOXGLQJ\RXWKDQGDGXOWVDQGZLOO EHRSHQWRSDUWLFLSDQWVRIDOOVNLOOOHYHOVDQG EDFNJURXQGV(DFKFRPPXQLW\SDLQWLQJHYHQWLV H[SHFWHGWRHQJDJHDSSUR[LPDWHO\ದ SDUWLFLSDQWV7KHFXOPLQDWLQJFRPPXQLW\ VKRZFDVHHYHQWLVH[SHFWHGWRGUDZ DSSUR[LPDWHO\RUPRUHFRPPXQLW\PHPEHUV GHSHQGLQJRQYHQXHFDSDFLW\DQGIRUPDW 2YHUDOOWKHSURMHFWLVHVWLPDWHGWRVHUYH DSSUR[LPDWHO\1HZSRUW%HDFKUHVLGHQWV ZLWKVRPHSDUWLFLSDQWVDWWHQGLQJPRUHWKDQRQH HYHQW$OOFRPPXQLW\SDLQWLQJHYHQWVDQGWKH SXEOLFVKRZFDVHZLOOEHIUHHDQGRSHQWRWKH 1HZSRUW%HDFKFRPPXQLW\ 352-(&7%8'*(7([SHQVHV3HUVRQQHO $UWLVWLF )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV $GPLQLVWUDWLYH )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV ,Q.LQG 7HFKQLFDO3URGXFWLRQ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 352-(&7%8'*(7([SHQVHV2SHUDWLQJ )DFLOLW\([SHQVH6SDFH5HQWDO )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 0DUNHWLQJ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 179 33URGXFWLRQ([KLELWLRQ([SHQVH )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 7RXULQJ3UHVHQWDWLRQ([SHQVH )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV (GXFDWLRQ0DWHULDOV )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 7UDQVSRUWDWLRQ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV (TXLSPHQW )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV 2WKHULIJUHDWHUWKDQDQQRWDWHEHORZ )XQGLQJIURPWKH&LW\RI1HZSRUW%HDFK )XQGLQJIURP2WKHU6RXUFHV *5$1'727$/ ([SHFWHG4XDQWLILDEOH2XWFRPHV IUHHSXEOLFFRPPXQLW\SDLQWLQJHYHQWV GHOLYHUHGLQ1HZSRUW%HDFK ದSDUWLFLSDQWHQJDJHPHQWVDFURVVWKH WKUHHSDLQWLQJHYHQWVPHDVXUHGE\SDUWLFLSDQW VLJQLQVKHHWV ODUJHVFDOHFRPPXQLW\DUWZRUNVRQWH[WLOH FDQYDVFROODERUDWLYHO\FRPSOHWHGDQGSUHSDUHG IRUSXEOLFSUHVHQWDWLRQ SXEOLFFRPPXQLW\VKRZFDVHHYHQWSUHVHQWHG LQ1HZSRUW%HDFK 'HVFULEHWKHH[SHFWHGTXDQWLILDEOHRXWFRPHV RI\RXUSURMHFWSURJUDPDQGKRZ\RXZLOO HYDOXDWHWKHUHVXOWV%HYHU\VSHFLILFLQ DGGUHVVLQJWKHZD\VWKDW\RXZLOOGHWHUPLQHWKDW \RXUSURMHFWSURJUDPPHWWKHQHHGVWKDW\RX LGHQWLILHGDQGDFFRPSOLVKHVWKHJRDOV\RXVHWRXW WRDFKLHYHLH\RXSURYLGHKRXUVRIPXVLFDO LQVWUXFWLRQDQGLQVWUXPHQWVWRWKHFKLOGUHQDW 1HZSRUW(OHPHQWDU\VFKRRODVPHDVXUHGE\ PXVLFVWRUHUHQWDOUHFHLSWVDQGORJVRI LQVWUXFWRUV 180 $SSUR[LPDWHO\ದVKRZFDVHDWWHQGHHV GHSHQGLQJRQYHQXHFDSDFLW\DQGIRUPDW (VWLPDWHGWRWDOSURMHFWUHDFKDSSUR[LPDWHO\ 1HZSRUW%HDFKUHVLGHQWV (YDOXDWLRQ0HWKRGV 3DUWLFLSDQWVLJQLQVKHHWVDWHDFKFRPPXQLW\ SDLQWLQJHYHQWWRGRFXPHQWDWWHQGDQFHDQG SDUWLFLSDWLRQ 9LVXDOGRFXPHQWDWLRQDQGFRPSOHWLRQUHFRUGV FRQILUPLQJWKHFUHDWLRQRIWKUHHILQLVKHGWH[WLOH DUWZRUNV $WWHQGDQFHHVWLPDWHVDWWKHFRPPXQLW\ VKRZFDVHHYHQWEDVHGRQYHQXHFRXQWVDQGRQ VLWHWDOOLHV %ULHISDUWLFLSDQWIHHGEDFNVXUYH\VSDSHURU GLJLWDODVVHVVLQJDFFHVVLELOLW\HQJDJHPHQWDQG RYHUDOOVDWLVIDFWLRQZLWKWKHDUWH[SHULHQFH 7KHVHHYDOXDWLRQPHDVXUHVZLOOGHPRQVWUDWH ZKHWKHUWKHSURMHFWVXFFHVVIXOO\H[SDQGHG DFFHVVWRIUHHSDUWLFLSDWRU\YLVXDODUWV H[SHULHQFHVHQJDJHG1HZSRUW%HDFKUHVLGHQWV LQFROODERUDWLYHDUWPDNLQJDQGPHWWKH FRPPXQLW\QHHGIRULQFOXVLYHSODFHEDVHGDUWV SURJUDPPLQJ //LVWRI%RDUG0HPEHUVDQGWKHLUDIILOLDWLRQV 5HFHQWOLVWRILQGLYLGXDOVFRUSRUDWLRQVDQG IRXQGDWLRQVWKDWSURYLGHRUJDQL]DWLRQDOVXSSRUW ,56'HWHUPLQDWLRQ/HWWHULI\RXDUHD FbLQGLFDWLQJWD[H[HPSWVWDWXV 2QHEURFKXUHDQGRURQHSUHVVFOLSSLQJ , ,QFRPHFDVKRQO\ &RQWULEXWHG )<%XGJHWFXUUHQW Document found on page 11. Document found on page 12 Document found on page 13. Document found on page 14. 181 ))<%XGJHWSURMHFWHG (DUQHG )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 7RWDO,QFRPH )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG ,, ([SHQVHV 3URJUDP )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG *HQHUDODQG$GPLQLVWUDWLYH )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 0DUNHWLQJDQG'HYHORSPHQW )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 7RWDO([SHQVHV )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG ,WHP ,,, 2SHUDWLQJ6XUSOXV'HILFLW,QFRPHPLQXV([SHQVHV )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG ,9 )XQG%DODQFHDW%HJLQQLQJRI<HDU )<%XGJHWFXUUHQW )<%XGJHWSURMHFWHG 182 99 $FFXPXODWHGG6XUSOXVV'HILFLW$GGGOLQHVV,,,,DQGG,9 )<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG ,WHPP 9, ,Q.LQGG&RQWULEXWLRQVVDWWDFKKVFKHGXOHVVLIIJUHDWHUUWKDQQRIIWRWDOOLQFRPH )<<%XGJHWWFXUUHQW )<<%XGJHWWSURMHFWHG ,,YHULI\\WKHHNQRZOHGJHHWKDWWWKHHLQIRUPDWLRQQ VXEPLWWHGGLQQWKLVVDSSOLFDWLRQQLVVWUXHHDQGGFRUUHFWWWRR WKHHEHVWWRIIP\\NQRZOHGJH 1DPH $]L6KDULI 7LWOH ([HFXWLYH'LUHFWRU /DVWW8SGDWH 6WDUWW7LPH )LQLVKK7LPH 3RZHUHGE\)RUPVLWH 183 % &'#$#$ ' 92-3564940 ' !" " • !% o! !# !$ ! •#% " o! !"! ! • !%!$ o! !!## "# 184 % &'#$#$ ' 92-3564940 ' !" " #" ! "! •#""!% • "!! •!% $!& ! • "!% "! • " #! "! •" #! "! •!! ! "% "! 185 Letter 947 (Rev. 2-2020) Catalog Number 35152P Department of the Treasury Internal Revenue ServiceTax Exempt and Government EntitiesP.O. Box 2508 Cincinnati, OH 45201 WILDLIFE JEWELS C/O: MOHAMMAD SHARIFZADEH 21 WHITE WATER DRIVECORONA DEL MAR, CA 92625 Date: 07/05/2023 Employer ID number: 92-3564940 Person to contact: Name: Mr. Mayom ID number: 31726 Telephone: 877-829-5500 Accounting period ending: December 31 Public charity status: 509(a)(2) Form 990 / 990-EZ / 990-N required: Yes Effective date of exemption: March 21, 2023 Contribution deductibility: Yes Addendum applies: No DLN: 26053523004643 Dear Applicant: We're pleased to tell you we determined you're exempt from federal income tax under Internal Revenue Code (IRC) Section 501(c)(3). Donors can deduct contributions they make to you under IRC Section 170. You're also qualified to receive tax deductible bequests, devises, transfers or gifts under Section 2055, 2106, or 2522. This letter could help resolve questions on your exempt status. Please keep it for your records. Organizations exempt under IRC Section 501(c)(3) are further classified as either public charities or private foundations. We determined you're a public charity under the IRC Section listed at the top of this letter. If we indicated at the top of this letter that you're required to file Form 990/990-EZ/990-N, our records show you're required to file an annual information return (Form 990 or Form 990-EZ) or electronic notice (Form 990-N, the e-Postcard). If you don't file a required return or notice for three consecutive years, your exempt status will be automatically revoked. If we indicated at the top of this letter that an addendum applies, the enclosed addendum is an integral part of this letter. For important information about your responsibilities as a tax-exempt organization, go to www.irs.gov/charities. Enter "4221-PC" in the search bar to view Publication 4221-PC, Compliance Guide for 501(c)(3) Public Charities, which describes your recordkeeping, reporting, and disclosure requirements. Sincerely, Stephen A. Martin Director, Exempt Organizations Rulings and Agreements 186 % &'#$#$ ' 92-3564940 ' !" " !##!-#)1!)-'&(* 2)%&%'(&!*(*)%+*!&%&(%!0*!&%-!* $!))!&%*&!%)'!(%$'&-(* &$$+%!*/*&,#+-!##!* (&+ (*%#(%!% %* &$$+%!*/* (&+ ,!)+#(*)(*!,.'(!%)%'+#!+#*+(# '(&($$!%!%)'!(/#&#-!##!%%*+( (&+ %)&%(**!,!*!)%'+#! '()%**!&%)-'(&,!))!#&''&(*+%!*!)&(/&+* %+#*)*&.'#&((*!,!*/ +!#(*!)*!)"!##)%&%%*-!* -'&(* 3))%)&'#* (&+ (* • &$$+%!*/!%*!% &##&(*!,(*,%*) ( %)&%&$$+%!*/(*$"!%.'(!%))!%&(##)"!###,#) •&+* $!#/!)+#(*)&(") &') +!'!%*!%%(**!,!*!)* *+!#&+%*!&%#(*)"!##)!%%!%#+)!,)**!% •+#!(* &-)). !!*!&%) &$$+%!*/!%'()%**!&%)* *#(*'(*!!'%*(*-&("!%!,!)') • &&# )!)+#(*)(&($)!#! &&# !)+#(*)-&(") &')*+(!%'&##!%*&(%)#!* $) •!##!-#) &##*!&%)!%(*). !!*!&%) (!!%#-!##!!%)'!((*-&(")/!##!-#). !!*!%&$$+%!*/%!,! )') 187 2025-26 CULTURAL ARTS GRANT APPLICATIONS ORGANIZATION Federal Tax ID Nº ADDRESS1 ADDRESS2 CITY ZIP WEBSITE GEOGRAPHICAL AREA PREVIOUS GRANT YEARS FOUNDED STAFF VOLUNTEERS A Backhausdance 05-0575068 P.O. Box 5890 Orange 92863 www.backhausdance.org Newport Beach, Orange County; Southern CA 2024-25 2020-2023 2003 14 20 B Baroque Music Festival, Corona del Mar 95-3785942 P.O. Box 838 Corona del Mar 92625 https://bmf-cdm.org Corona del Mar/Newport Beach, other Orange County cities, greater Southern California 2024-25 2017-2019, 2021- 2023 1980 1 PT 20 C Choral Arts Initiative 46-2778387 2160 Barranca Parkway #1262 Irvine 92606 https://www.choralartsinitiative.or g/ Orange County - Irvine/Newport Beach focus N/A 2013 28 0 D Emerald Magic Events Inc.99-2307904 1024 Bayside Dr.Ste. 538 Newport Beach 92660 https://www.emeraldmagicevents. org/ Orange County 2024-25 N/A 2024 2 7 E Pacific Chorale 95-2585505 3303 Harbor Blvd. Ste. #5 Costa Mesa 92626 www.pacificchorale.org Orange, Newport Beach, L.A., Riverside Counties 2024-25 2021-2023 1968 9 Full time, 60 Part time 170 F Pacific Symphony 95-3635496 17620 Fitch Ste. 100 Irvine 92614 www.pacificsymphony.org Orange County 2024-25 2018-2024 1978 50 1,839 G South Coast Repertory 95-6122708 655 Town Center Drive.P.O. Box 2197 Costa Mesa 92628 scr.org Orange County 2024-25 2019-2024 1964 97 200 H Wildlife Jewels 92-3564940 21 Whitewater Drive Corona del Mar https://www.wildlifejewels.org Newport Beach N/A N/A 2023 1 6 Page 1 of 2 ATTACHMENT I 188 2025-26 CULTURAL ARTS GRANT APPLICATIONS ORGANIZATION A Backhausdance B Baroque Music Festival, Corona del Mar C Choral Arts Initiative D Emerald Magic Events Inc. E Pacific Chorale F Pacific Symphony G South Coast Repertory H Wildlife Jewels PROGRAM REQUEST NB PEOPLE SERVED GRANTED 2025- 26 GRANTED 2024- 25 GRANTED GRANTED GRANTED GRANTED GRANTED GRANTED GRANTED 2023-24 2022-23 2021-22 2020-2021 2019-2020 2018-2019 2017-18 Dance Expressions: Creativity and Choreography is an in-depth dance education partnership with three schools in Newport-Mesa: Corona del Mar Middle/High School, Back Bay High School, and Newport Harbor High School serving over 130 Newport Beach teens directly. Students will be trained in various forms of dance by Backhausdance instructors and develop new choreography for the Fall 2026 Choreography Showcase at CDM Middle/Highschool on November 19-20, 2026 reaching 750+ students. $4,000 1,400 4,000 4,000.00$ 3,000$ 4,000$ 4,000$ 0 0 0 Funding would go towards a program, The Finale, which will present music by the evocative German-English composer of "Messiah," George Frideric Handel. Funds will be used to support travel for two internationally recognized soloists. Funds will also subsidize student rush ticketsfor all concerts and promote educational aspects of the program including a Baroque "101" symposium for local music educators, students, Festival subscribers, and current donors. $4,500 600 4,500 4,500.00$ 5,000$ 5,000$ 4,000$ 4,000$ 4,000$ 0 Funds would go towards a new program, "Memory & Renewal", a public contemporary choral performance in May 2026 at St. Mark Presbyterian Church in Newport Beach. The performance features works exclusively by living composers centered on themes of memory, community and renewal. The project will serve residents of Newport Beach and surrounding commmunities with expected attendance between 250-350 individuals. Outreach will target Newport Beach households, local schools, senior communities, and the San Joaquin Hills neighborhood. $3,500 300 N/A N/A N/A N/A N/A N/A N/A N/A "Classical in the Park" is a series of two outdoor educational events celebrating the history and heritage of classical music. Taking place at the Bonita Greek Community Center and the Newport Beach Junior Lifeguard Building and using live-to-headphones format, local music schools will introduce children and families to the great composers (Mozart, Beethoven, Vivaldi, and more) through engagging stories and live performances. Young performers will join the professionals on stage as well. The combined attendance for both events is anticipated at 500. $5,000 500 2,000 N/A N/A N/A N/A N/A N/A N/A Pacific Chorale's chamber choir will present Eric Whitacre's The Sacred Veil and Three Songs of Faith in March at Our Lady Queen of Angels Church in Newport Beach. Funds will also be used for a holiday program, Carols by Candlelight, which features traditional and contemporary holiday music. Anticipated crowds will be around 650 people for two Carols by Candlelight performances and more than 500 people for the Sacred Veil performance. Up to 100 tickets for each program will be offered for free to local schools and social service agencies. $5,000 1,800 3,500 3,500 5,000.00$ 4,500$ 5,000$ 0 0 0 0 Funds will provide The Class Act Music Education program at Newport Coast Elementary, which places Pacific Symphony union musicians into schools where students recieve music learning from teaching artists. Through year-long residencies in each school, musicians focus on the fundamentals of music through classroom instruction, on-site school performances and a trip to the concert hall for a full Pacific Symphony performance. Class Act engages the entire student body at Newport Coast, serving 469 children, 22 teachers, and 1 principal. $5,000 492 5,000 5,000 3,500.00$ 5,000$ 5,000$ 5,000$ 5,000$ 5,000$ 0 The Theatre for Young Audiences (TYA) program, running since 2003, introduces young audiences to live theatre. Fpr the 2025-26 season, TYA will run a production of Cinderella: A Salsa Fairy Tale , a a bilingual and family-friendly musical, will run 14 free school-day matinee shows for local students, particularly Title 1 schools within Newport Beach. Bus transportation subsidies will be provided, and TYA provides study guides and program booklets to help integrate themes from the play into classroom learning. $5,000 1,700 3,500 3,500 5,000.00$ 4,500$ 3,000$ 8,750$ 5,000$ 0 0 The proposed project, The Art of Newport Beach Wildlife: Community Painting & Showcase, is a new visual arts program consisting of three free, public collaborative painting events in which Newport Beach residents collectively create three large-scale artworks on textile canvas, culminating in a public community showcase event. Open to all ages, participants will paint directly onto a shared large-format textile canvas with guidance from teaching artists on composition, technique, and color palette to ensure each artwork is visually unified and exhibition-ready. $2,700 200 N/A N/A N/A N/A N/A N/A N/A N/A N/A $34,700 Page 2 of 2189 I-10 1 CULTURE AND ARTS GRANTS The City Council hereby recognizes the importance of promoting culture and the arts within Newport Beach. Pursuant to City Council Policy A-12, the City budget specifically allows the City Council to direct revenue towards worthy projects and programs which the City Council deems beneficial to the quality of life for Newport Beach’s residents. A number of individuals and groups have been organized with the express purpose of developing and promoting culture, theatre and the arts. In regard to the City's role in financially sponsoring art and cultural events, up to $55,000 shall be expended from the General Fund for culture and arts grants each fiscal year. The City Arts Commission shall review all programs and requests for support from arts groups. The Commission shall forward its recommendations for funding to the City Council for final approval. For the purpose of this policy, arts groups shall be defined as those involved in visual, musical, theatre, dance, crafts, performing and literary activities. The following priorities shall be considered by the Commission. The order of preference for granting support shall be as follows: A.Local arts groups located within the City and offering programs to City residents; B.Regional arts groups located in Orange County and offering programs to City residents; and C.Arts groups located in California and performing or offering programs to City residents. Groups not offering programs or services to local residents shall not be eligible for support from the City. History Adopted F-20 – 5-11-1981 (“Reserve Fund for Culture and Arts”) Amended F-22 – 6-22-1981 Adopted I-20 – 1-24-1983 (“Co-Sponsorship for Cultural Events and Arts Groups”) Amended F-20 – 11-14-1983 Amended F-20 – 1-23-1984 Amended F-20 – 3-28-1988 Amended F-20 – 10-28-1991 Created I-12 – 1-24-1994 (incorporating I-20 and F-20, and renaming “Financial Support for Culture and Arts”) Amended I-12 – 5-8-2001 Amended I-12 - 4-8-2003 (changed to I-10) Amended I-10 – 8-8-2017 Amended I-10 – 11-12-2024 ATTACHMENT J 190 February 12, 2026 Agenda Item No. 6 CENTRAL LIBRARY GALLERY EXHIBITS Hugo Zhang presents Hugo’s World: Silver Gelatin Contact Prints December 15, 2025 – February 6, 2026, Central Library One of the few obsessions in Hugo’s life is making photographic images with his wooden cameras. He likes to roam around and let his gaze linger upon faces, flowers, trees, waters, sea rocks and clouds. Shifting lights and shadows often play magic upon things. When he sets up his camera and studies the reflected images on the ground glass under the dark cloth, it appears things come alive and reveal themselves in moments of silence. Hugo’s way of image making is old and pure: each image is captured by a sheet of silver film in the camera by a click of shutter. That sheet of film is developed in the darkroom and then pressed onto a sheet of silver paper and contact printed. There are no enlargements and no digital processing. Straightforward and simple. By capturing their images on silver paper, he hopes to bear witness to their unique glory. As an artist, Hugo is always on a journey of exploration and discovery. His goal is to make ordinary things extraordinary. He hopes that viewers of these images can share his joy of these discoveries. Upcoming Installations 2026 •February 9 - April 3: Soung Park (Digital Photography) •April 6 - May 29: Dennis Carrie (Historical Figures/Portrait Painting) TO: CITY ARTS COMMISSION FROM: Library Services Department Melissa Hartson, Library Services Director (949)717-3801, mhartson@newportbeachca.gov PREPARED BY: Rebecca Lightfoot, Library Services Manager TITLE: Cultural Arts Activities – January 2026 191 CULTURAL ARTS CALENDER OF EVENTS: City Arts Commission (CAC) meetings are held at 5 p.m. on the second Thursday of each month. •2025-26 CAC Regular Monthly Meetings: o February 12, 2026 o March 12, 2026 o April 9, 2026 o May 14, 2026 o June 11, 2026 CULTURAL ARTS GRANTS: City Council will hear the Commission’s recommendation for the Cultural Arts Grants at their February 24, 2026, meeting. MAYOR’S EGG RACE: City Arts Commissioners are invited to attend the 11th annual Mayor’s Egg Race on Saturday, March 28, 2026, at the Civic Center Green. The Arts Commission is hosting a Spin Art Booth. NOTICING: This agenda item has been noticed according to the Brown Act (72 hours in advance of the meeting at which the City Arts Commission considers the item). 192 Memo To: City Arts Commission From: Vanessa Moore, Vice Chair Date: Monday, February 2, 2026 Re: Public Relations and Marketing Ad Hoc Subcommittee report The Public Relations and Marketing Ad Hoc Subcommittee met and identified several opportunities for the Newport Beach Arts Foundation to recognize and incentivize sponsors and donors through the City’s Concerts on the Green and Pacific Symphony. The commission leadership committee will present these opportunities to the Foundation at our earliest opportunity either the February or March foundation meeting, or a meeting with foundation leadership to determine whether they would like to pursue sponsorships in the form of the following: -VIP tables -Names/logos on the banner of stage -Verbal announcements at events -Print materials -Step and Repeat -Opportunities to sponsor the children’s activities Under this proposed structure: • The Arts Foundation would be solely responsible for securing financial sponsorships. • The Commission would remain responsible for event operations and programming. • Any funds secured through sponsorships, should the Foundation choose to pursue them,would be noted to donors that they would be used to elevate current Arts commission programs 193 and support new arts programming and events for the city through the Arts Commission. The goal for the sponsorships is to raise more funds for the Commission for refreshed and exciting new community arts events for our residents. 194